KEGG   Vanderwaltozyma polyspora: Kpol_1036p72Help
Entry
Kpol_1036p72      CDS       T01049                                 

Definition
hypothetical protein
Orthology
K00866  
choline kinase [EC:2.7.1.32]
Organism
vpo  Vanderwaltozyma polyspora
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylcholine (PC) biosynthesis, choline => PC
Brite
KEGG Orthology (KO) [BR:vpo00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Kpol_1036p72
Enzymes [BR:vpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     Kpol_1036p72
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 592 aa AA seqDB search
MPVERKARSEVSRGQQTNYVKSRSRSRSSSKTRNSLTIQVSSNRSVRAISVDSDNESAID
DGSETSMSLKMQGLNLDENQNVNSDDGNGNVGASASANGGGEYIEVPFVEAILDTSLPSD
YLKDDILNIAQSLKVPKWYVKGAQGVSPLKREFLKMTQITGAMSNVIYKLEYPHLPSLLL
RVYGPNIDSIIDRDYELQILARLSLQNIGPSLFGCFTNGRFEQFLENSQTLTKDDIRDWK
TSQRIARRMKELHIGVPLLRSEREGGPACIKLINKWMTNVETIGKEWISDNENINDVLFA
SDWSTFRKVVARYVQWLKDEETGKYKEKLVFCHNDTQYGNLLLSAPVTRTEPNTPSGTRS
TASLSSLFPTSSNISLDDIIFPPKEEKVQDDKLIVIDFEYAGPNPAAFDLANHFSEWMHD
YHSSEPYKCNSKAFPTKEQELNFLYSYVSHLRGGAKNSIDDEVRTYYNSIIRWRASVQLF
WSLWAIIQSGKLEEKELEHIEMTKEAQAPSGNKYIIKTELIDSSEDGSTSQETTEESSQE
EANGADIGSFDYMGFCRDKISLFWGDLFNLGIIERDECSVPLEKNFLDVKFL
NT seq 1779 nt NT seq  +upstreamnt  +downstreamnt
atgccagttgaaaggaaagctagaagtgaagtttctcgcggtcaacaaactaattatgtt
aagtctcgttcacgttcgagatcttcgagcaagactagaaattcgttgactattcaagtt
agttctaatagatcagtgcgagctattagtgttgattccgataatgaatctgctatagat
gatggatctgagacttctatgtctcttaagatgcaaggtttgaatttagatgaaaaccaa
aatgtgaatagtgatgacggtaatggaaatgttggtgctagtgctagtgctaatggtggt
ggtgagtatattgaagttccctttgttgaagctatactggatacctctctacctagtgat
tatttgaaagatgatattttaaatattgctcagagtttaaaggttccaaaatggtatgtt
aaaggagcacagggtgtctcaccattgaaaagagagtttcttaaaatgacacaaataact
ggtgcaatgagtaatgttatttataaattggaataccctcatttgccttcattgctgttg
agggtttacggtcctaatattgattctattattgatagagattatgaattacagatttta
gcaagattatcattacaaaatattgggccatctttattcggttgttttacaaatggtaga
tttgaacaatttttagaaaattctcaaactttaactaaggatgatattagagattggaag
acctctcaacgtatcgctcgtagaatgaaagaacttcatattggtgtacctcttttacgt
tcagaaagagaaggtgggccagcatgtataaaattaataaataaatggatgacaaatgtg
gaaacaataggtaaagaatggattagtgataacgaaaatattaatgacgtattattcgca
agcgattggtcaacctttagaaaagttgtggcccgttatgttcaatggttaaaggatgaa
gagactgggaaatacaaagaaaaattggtcttttgtcataacgatacacaatatggtaat
ttactgttaagtgctccggtcactagaacagaaccaaatacccctagtggcactagatca
actgcttctttatcatctttatttccaacttcatcaaatatttccttggatgatattatt
ttccctccaaaggaagaaaaagttcaagatgataaattgatagtcatagattttgaatat
gctgggccaaaccctgctgcattcgatttagcaaaccacttcagtgagtggatgcatgat
tatcactcatcggagccttacaagtgcaattcgaaggctttcccaacaaaggaacaggaa
ttaaacttcttgtattcatacgtatcgcatttgagaggtggtgcaaagaattcaatcgat
gacgaagtcagaacatactataattctatcattagatggagagcaagtgtacaattattc
tggagtttatgggcaattattcaaagtggtaaattagaagaaaaagaattagagcatatt
gaaatgacaaaagaagctcaagcaccaagtggtaacaaatatataattaagacagaacta
atagatagtagcgaagatggtagcactagtcaggaaactacagaagaatcatctcaagaa
gaagccaatggtgcagatattggaagttttgattatatgggattctgtagagataaaata
tcattattctggggtgacttgtttaatttaggcattatcgaaagagatgaatgttctgtt
ccccttgaaaaaaattttttggacgtaaaattcctataa

DBGET integrated database retrieval system