KEGG   Vanderwaltozyma polyspora: Kpol_1037p12Help
Entry
Kpol_1037p12      CDS       T01049                                 

Definition
hypothetical protein
Orthology
K13333  
lysophospholipase [EC:3.1.1.5]
Organism
vpo  Vanderwaltozyma polyspora
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:vpo00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Kpol_1037p12
Enzymes [BR:vpo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Kpol_1037p12
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 670 aa AA seqDB search
MQLQNLLLLSAVAGLPAAVDAWSPSNSYAPGNVSCPANANFVRAGGKLSDEEIDWLAKRE
VYTTESLKDFMTRAMANFTDSSILDQLFGSSNSSNVPKIAVAASGGGYRAMLSGAGMISA
MDNRTVGANEHGLGGLLQSTTYLAGLSGGNWLVGTLAWNNWTSVQDIVNNFTKDDSIWDI
SNSIFTPGGLDIAKTVLRWNHISDAVKDKQEAGFNVSLTDIWGRALSYGFFPSLKRGGEA
YTWSTLREAQVFQDGAMPFPISVADGRYPGSYIINLNATLFEFNPFEMGSWDPTLNAFSD
VKYLGTNVTNGTPVNTDVCVEGYDNTGFIMGTSSSLFNQFLLRLNTTGLNSFIQDIVRHY
LVDLSNESDDIAIYAPNPFKNTNHIKSNYSQVLSETDYLFLVDGGEDQQNIPLVPLLQKE
RDIDVIFALDNSADTNNSWPNGASLVNTYQRQFESQGVNIAFPYVPDTNSFVNLGLNRKP
TFFGCEASNMTSLRQTPPLVVYIPNSKYSYASNQSTFKMSYSKKERIGMIQNGFEAATRG
NFTYDPEFIGCVACAILKRKQESLNATLPAECEACLTTYCWNGTISNDPNSADEIDNGEP
DTILSTTSSKKSGKTSTSKSSKSSKTTSTDNSKSGSSDSTKSGSVHVVSPYDFTTILTFI
LGVSVISFYI
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atgcaattgcagaatctattgttgttatcggcagtggcgggtttgccagctgccgtagac
gcctggtctccttcaaacagctatgctccaggcaacgtctcctgtcctgctaacgctaac
ttcgtcagagctggtgggaaattgtctgatgaagaaatcgactggttggcaaagagagag
gtctacaccactgagagtttgaaggatttcatgacaagggcaatggccaacttcaccgat
tcctcaatcttggatcaactgttcggttcttcaaactcaagcaatgtccctaaaatcgct
gtcgctgcctctggtggtggttacagagctatgttgagtggtgctggtatgatctcagcc
atggacaacagaaccgtgggtgcaaacgaacacggtcttggtggtttgttgcagagtact
acttatttggctggtttatccggtggtaactggctagtcggtactttggcatggaataac
tggacttcagtccaagatatagtgaacaacttcacaaaggatgactccatctgggatatc
tcaaacagtatcttcacccctggtggtttggacatcgcaaaaaccgtgctaagatggaat
cacatctcagatgctgtgaaggataaacaggaagcaggctttaacgtatccttgactgat
atctggggtcgtgctctatcctacggtttcttcccttctttgaaaagaggtggtgaagct
tacacttggtccactttaagagaagctcaagttttccaagacggtgctatgcctttccca
atctctgtcgctgatggtaggtaccctggttcttacattatcaacttgaacgctacttta
ttcgaattcaatcctttcgaaatgggttcctgggatccaactttaaatgccttctctgat
gttaagtatttgggtactaacgtaactaacggtacccctgtcaacaccgacgtttgtgta
gaaggttacgacaacactggtttcatcatgggtacttcctcaagtttgttcaaccaattc
ttgttgagattgaacaccacaggtttgaactcatttatccaagatattgttagacattat
ttggtcgatttatcaaacgaatccgatgatatcgccatttacgctccaaatcctttcaag
aacactaaccatatcaagagcaactactctcaagtactatctgaaaccgattacttattc
ttggtcgatggtggtgaagatcaacagaatatcccattggttccattactacaaaaagaa
cgtgacatagatgtcatctttgccttggataattccgctgacaccaacaattcatggcca
aacggtgcctccctagttaacacttaccaacgtcaattcgaatcacaaggtgttaacatt
gctttcccttacgttccagacacaaacagttttgttaacttgggtttgaacagaaaacca
actttcttcggttgtgaagcctctaacatgactagtttgagacaaactccacctttggtt
gtttacattccaaactcaaagtattcttatgctagtaaccaaagtactttcaagatgtct
tactctaaaaaggagcgtatcggtatgatccaaaatggtttcgaagcagccactagaggt
aatttcacttatgaccctgaattcatcggttgtgttgcttgtgctatcttaaagcgtaag
caagaaagtttgaatgcaactttgcctgctgaatgtgaagcatgtttgaccacttactgt
tggaacggtaccatcagcaatgatccaaacagtgcggatgaaattgataacggtgaacct
gataccattttaagtactacttcttccaagaaatctggtaagacatctacttcaaagtct
tcaaaatcttcaaagactacttcaactgataattctaaatcaggttcatcagactcaacc
aaatcaggttctgtccacgttgtttcaccatatgactttacaacaattttgacattcatt
ttgggtgtttcggtcatttctttctatatttga

DBGET integrated database retrieval system