KEGG   Vanderwaltozyma polyspora: Kpol_1038p11Help
Entry
Kpol_1038p11      CDS       T01049                                 

Definition
(RefSeq) hypothetical protein
  KO
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
vpo  Vanderwaltozyma polyspora
Pathway
Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:vpo00001]
 Organismal Systems
  Aging
   04213 Longevity regulating pathway - multiple species
    Kpol_1038p11
Enzymes [BR:vpo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     Kpol_1038p11
Chromosome [BR:vpo03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class I HDACs
     Kpol_1038p11
   HDAC complexes
    Sin3A-HDAC complex
     Kpol_1038p11
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    Kpol_1038p11
  Chromatin remodeling factors
   NuRD complex
    Kpol_1038p11
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 433 aa AA seqDB search
MVYEAKPFDPIVVKPNDKKRVAYFYDADVGNYAYGAGHPMKPHRIRMTHSLVMNYGLYKK
MEIYRAKPATKQEMCQFHTDEYIDFLSRVTPDNLDMFKKESVKFNVGDDCPVFDGLYEYC
SISGGGSMEGAARLNRGKCDVAINYAGGLHHAKKSEASGFCYLNDIVLGIIELLRYHPRV
LYIDIDVHHGDGVEEAFYTTDRVMTCSFHKYGEFFPGTGELRDTGVGKGKNYAVNVPLRD
GIDDATYRAVFESVISKIMEWYQPSAVVLQCGGDSLSGDRLGCFNLSMRGHANCVNFVKS
FGIPLMVVGGGGYTMRNVARTWCFETGLLNNVILDEDLPYNDYYEYYGPDYKLDVRPSNM
YNVNSPDYLDKILTAIHSNLESTKYAPSVQLNHVPHDLEDKGDEEEDTKEAIDTKGGSQY
ARDQIVEKDNEFY
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atggtgtatgaagctaaaccttttgaccctatagtggtgaaacctaatgataagaaaagg
gtagcttatttttacgatgctgatgttggtaactatgcgtatggtgctggtcatcccatg
aagccacatagaataagaatgacacattctttggttatgaattatggtttgtataaaaag
atggaaatttatagggctaaacctgctacaaaacaagagatgtgtcaattccatactgat
gaatatatcgactttttatcccgtgtaactcctgataatttagatatgtttaagaaggaa
agtgtgaaatttaatgtaggtgatgattgtcctgtttttgatgggttgtatgaatattgt
agtatatctggtggtggctcaatggaaggtgccgctaggttaaatcgcggtaaatgtgat
gttgcaattaactatgctggtggtttacaccatgctaaaaaatcagaagcttctggtttc
tgttatttgaatgatattgttttaggtattatagaattgttaagatatcatccaagagtc
ctatatattgatatcgatgttcatcatggtgatggtgttgaagaagcattttatactaca
gaccgtgtcatgacttgttcatttcataaatatggtgaattcttcccaggtactggtgag
ttaagagatactggtgtagggaaaggtaagaactacgcagtcaatgttcctctaagagat
ggtatagatgatgccacttatagagcagttttcgaatcagtcatcagcaagattatggaa
tggtatcaaccatcggcggtagtattgcaatgtggtggtgattctctatcaggtgatcgt
ttgggttgtttcaacctttccatgcgtggtcacgctaactgtgtcaattttgtcaagtct
tttggtattcctttaatggttgttggtggtggtggttatacaatgagaaatgttgcaaga
acgtggtgttttgaaactgggttattaaacaatgtaatattagatgaagatctgccttat
aatgattattatgaatattatggtccagattataaattagatgttaggccatcaaacatg
tataacgtaaactctccagattatttggataaaattttaactgctattcattccaactta
gaaagcaccaaatatgccccaagtgtgcagctgaaccatgttcctcacgatctagaagac
aaaggtgacgaagaagaagatacaaaagaagctatagataccaaaggtggttctcaatat
gctagagaccaaattgtagagaaagataatgaattttactga

DBGET integrated database retrieval system