KEGG   Vanderwaltozyma polyspora: Kpol_1039p32Help
Entry
Kpol_1039p32      CDS       T01049                                 

Definition
hypothetical protein
Orthology
K11407  
histone deacetylase 6 [EC:3.5.1.98]
Organism
vpo  Vanderwaltozyma polyspora
Brite
Enzymes [BR:vpo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     Kpol_1039p32
Protein phosphatases and associated proteins [BR:vpo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Kpol_1039p32
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 659 aa AA seqDB search
MMSSLSYTPLKTGLCYDVRMRYHAKIYTSYYEYIDPHPEDPRRIYRIYKILAENGLIRDP
ALSGIDDIGDLMCKIPVREATSEEILEVHPKEQLEYLEKTQYLNRDELLSKTELGDSVYF
NNDSYFSAKLSCGGAIEACKAIVDGKVKNSLAIVRPPGHHSEPEVAGGFCLFSNVAVATK
NILKNYPDKVKKVMIVDWDIHHGNGTQKAFYNDDRVLYVSLHRFELGKYYPGTIHGQYDQ
VGEGKGEGFNCNIPWSVGGIGDAEYIWAFEQIVMPMGREFRPDLVIVSSGFDAADGDTIG
KCHVTPSCYGHMTHMLKSLANGKLCVVLEGGYNLDAIARSALAVAKVLIGEPPDELPAPD
KDPKPEAIEMIDRVIDLKSKYWKCFKRQITNSNCEYKGPISESFFAKKFPIQDAIRAQQI
QYLTNDYNMVPLPLMNSNLPEDTVMCSTDILQSNVAIIYVHDTPEIWSKRDAIAGVIDSS
ASLYMDASLQFYDWALDRGYGIIDVNIPQTLYEQDNYSASLTAQEVLIKLWDNNLKYFPN
VNKIAYIGVGEAYSGLVHLLGHRDTRSVVKSVIGFVGKKPLKALVPLVEESLADWYFKTS
LLFADKNHSCWGENDSKKPRKRYGRVLRCDSDGIFSLIEERFEEATDFIIDSLDEWTEE
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atgatgtctagcttatcatatactcctttgaaaactggtctttgttacgatgtcagaatg
agataccatgcaaaaatatatacttcatattatgaatatatagacccgcatcctgaagac
cctagacgtatttaccgtatctacaagattctggctgaaaatgggctgattagagatcct
gctctttcaggtatcgacgatatcggcgatttaatgtgcaaaattccagtaagagaagct
acctctgaagaaatattagaggtccatccaaaggagcaattagaatatttagagaaaact
caatacctgaatagagatgaattgttgagtaaaactgaactaggtgattcggtatatttc
aataacgattcttattttagtgccaaattatcttgtggtggtgcgattgaagcttgtaaa
gctatagttgatgggaaagtaaaaaattcattagcgattgttagaccaccaggccaccat
tctgaacctgaagttgctggtgggttttgtttgtttagtaacgttgcagttgccaccaaa
aatattttaaaaaattatcctgacaaagttaagaaagtaatgattgtagattgggatatt
caccatggtaatggtactcaaaaggctttttacaatgacgatagagttctctatgtctca
ttgcatcgatttgaattgggtaagtattatccaggtaccattcatggtcaatatgaccaa
gtaggcgagggcaaaggtgaaggtttcaattgtaacataccttggtcagtaggtggtatc
ggagatgcagaatatatttgggcttttgaacaaattgtaatgcccatgggtcgtgaattc
agacctgacttagtgatagtatcctctggtttcgatgctgccgatggtgacactatcggt
aaatgtcatgttaccccaagctgttatggccatatgacacacatgttaaaatcattagct
aatggtaagttatgtgtagttttagaaggtggttataatttagacgcaattgcgagaagt
gctcttgctgtagcaaaagtcctgattggagaacctcctgatgagttacctgcgccagat
aaagatccgaagccagaagcaatagagatgattgacagagtaatagatttaaagtctaaa
tattggaaatgttttaagagacaaattacaaattcaaattgtgaatataagggacctata
tctgaatcattttttgccaaaaaattcccaattcaggatgcaattcgagctcagcaaata
caatacctgacaaatgattataatatggtacctttacctttaatgaattcaaatttacct
gaagatactgttatgtgtagtacggatattttgcaatcaaatgtagctatcatttatgtc
catgacacaccagagatttggtctaaaagagatgcaatagctggtgtgattgattcctcg
gcatctctatatatggatgcgtccttgcaattttatgattgggcattggacagaggttat
gggataattgatgtaaatataccgcaaacactttatgaacaagataactattctgcatca
ctgactgctcaagaggtcctaattaagttatgggataataatttgaagtattttccaaat
gttaataaaatcgcatatataggtgttggggaagcttattcagggttagtccacctatta
ggtcacagagacacaagatcagtagtcaagtcagtaattgggtttgttggtaaaaagcca
ttgaaggctctagttcctcttgtagaagaatcgctagcagattggtactttaaaacttcg
cttctatttgctgataaaaatcactcctgttggggggaaaacgatagcaaaaaaccaagg
aaacgttatggccgggtattaagatgtgatagtgacggtattttcagtttgatagaggaa
cggttcgaagaagcaacagattttataattgattccttagatgaatggactgaagagtaa

DBGET integrated database retrieval system