KEGG   Vanderwaltozyma polyspora: Kpol_1039p35Help
Entry
Kpol_1039p35      CDS       T01049                                 

Definition
hypothetical protein
Orthology
K00030  
isocitrate dehydrogenase (NAD+) [EC:1.1.1.41]
Organism
vpo  Vanderwaltozyma polyspora
Pathway
Citrate cycle (TCA cycle)
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:vpo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Kpol_1039p35
   01210 2-Oxocarboxylic acid metabolism
    Kpol_1039p35
   01230 Biosynthesis of amino acids
    Kpol_1039p35
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Kpol_1039p35
Enzymes [BR:vpo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.41  isocitrate dehydrogenase (NAD+)
     Kpol_1039p35
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 359 aa AA seqDB search
MFRNLISKRAFTSIASRENIIPKKYGGRYTVTLLPGDGVGREITDSVVSIFEAENLPIDW
ERVELSGLEQEDVHTAVESLKRNKIGLKGIWHTSADHDGHTSWNVALRKELDIYANVAIF
KSFKGVDTRIPDVDLVIIRENTEGEYSGLEHESVPGVVESLKIMTAQKTERIARFAFDYA
MKYNRKSVTAVHKANIMKLGDGLFRNLVTEIGAKEYPEVGVSSIIVDNASMQAVAKPHQF
DVMVAPSMYGTILGNIGAALIGGPGLVPGANYGRDYAVFEPGSRHVGLDIENQNIANPTA
MILSATLMLNHLGFRNDAARISKAVHEVIAEGKTTTRDIGGSATTTEFTNAVIAKLKTL
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgttcagaaatttaatctcaaagagagctttcacttcaattgcttctcgtgaaaatatc
atcccaaaaaaatacggtggtcgttataccgttactttattgcctggtgatggtgtaggt
agagaaatcaccgattctgtagtctctatcttcgaagctgaaaatttgccaatcgattgg
gaaagagtagaattgtcaggtttggaacaagaagatgttcatactgccgtggaatcctta
aaacgtaacaaaatcggtttgaaaggtatatggcacacctctgctgatcatgacggtcac
acttcttggaacgtagctctaagaaaagaattggatatttacgctaacgtagctatcttc
aagtccttcaagggtgtcgatacaagaattccagatgtcgatttggttatcatcagagaa
aataccgaaggtgaatactcaggtttggaacatgaatcagtaccaggtgtagtggaatct
ttaaagatcatgactgctcaaaaaactgaaagaatcgctagattcgctttcgattatgcc
atgaaatataacagaaaatcagtcactgctgttcataaggccaatatcatgaagttaggt
gacggtttatttagaaatttggtcacagaaatcggtgctaaagaatatccagaagttggt
gtctcttctattatcgtcgataacgcctccatgcaagctgtagctaaaccacatcaattc
gacgtcatggtcgctccttcaatgtatggtactattttgggtaacattggtgctgctttg
atcggtggtccaggtttggttccaggtgctaactacggtagagattatgctgtctttgaa
ccaggttccagacacgttggtttagatattgaaaaccaaaacattgctaatccaaccgca
atgatcttatctgctactttaatgttgaatcacttgggtttcagaaacgatgcagcaaga
atctcaaaggctgtccacgaagtcatcgccgaaggtaaaactaccactagagatatcggt
ggttctgctactaccacagaattcactaacgctgttatcgctaaattaaagactttataa

DBGET integrated database retrieval system