KEGG   Vanderwaltozyma polyspora: Kpol_1039p35Help
Entry
Kpol_1039p35      CDS       T01049                                 

Definition
hypothetical protein
Orthology
K00030  
isocitrate dehydrogenase (NAD+) [EC:1.1.1.41]
Organism
vpo  Vanderwaltozyma polyspora
Pathway
Citrate cycle (TCA cycle)
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Class
Metabolism; Overview; Carbon metabolism [PATH:vpo01200]
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:vpo01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:vpo01230]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:vpo00020]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 359 aa AA seqDB search
MFRNLISKRAFTSIASRENIIPKKYGGRYTVTLLPGDGVGREITDSVVSIFEAENLPIDW
ERVELSGLEQEDVHTAVESLKRNKIGLKGIWHTSADHDGHTSWNVALRKELDIYANVAIF
KSFKGVDTRIPDVDLVIIRENTEGEYSGLEHESVPGVVESLKIMTAQKTERIARFAFDYA
MKYNRKSVTAVHKANIMKLGDGLFRNLVTEIGAKEYPEVGVSSIIVDNASMQAVAKPHQF
DVMVAPSMYGTILGNIGAALIGGPGLVPGANYGRDYAVFEPGSRHVGLDIENQNIANPTA
MILSATLMLNHLGFRNDAARISKAVHEVIAEGKTTTRDIGGSATTTEFTNAVIAKLKTL
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgttcagaaatttaatctcaaagagagctttcacttcaattgcttctcgtgaaaatatc
atcccaaaaaaatacggtggtcgttataccgttactttattgcctggtgatggtgtaggt
agagaaatcaccgattctgtagtctctatcttcgaagctgaaaatttgccaatcgattgg
gaaagagtagaattgtcaggtttggaacaagaagatgttcatactgccgtggaatcctta
aaacgtaacaaaatcggtttgaaaggtatatggcacacctctgctgatcatgacggtcac
acttcttggaacgtagctctaagaaaagaattggatatttacgctaacgtagctatcttc
aagtccttcaagggtgtcgatacaagaattccagatgtcgatttggttatcatcagagaa
aataccgaaggtgaatactcaggtttggaacatgaatcagtaccaggtgtagtggaatct
ttaaagatcatgactgctcaaaaaactgaaagaatcgctagattcgctttcgattatgcc
atgaaatataacagaaaatcagtcactgctgttcataaggccaatatcatgaagttaggt
gacggtttatttagaaatttggtcacagaaatcggtgctaaagaatatccagaagttggt
gtctcttctattatcgtcgataacgcctccatgcaagctgtagctaaaccacatcaattc
gacgtcatggtcgctccttcaatgtatggtactattttgggtaacattggtgctgctttg
atcggtggtccaggtttggttccaggtgctaactacggtagagattatgctgtctttgaa
ccaggttccagacacgttggtttagatattgaaaaccaaaacattgctaatccaaccgca
atgatcttatctgctactttaatgttgaatcacttgggtttcagaaacgatgcagcaaga
atctcaaaggctgtccacgaagtcatcgccgaaggtaaaactaccactagagatatcggt
ggttctgctactaccacagaattcactaacgctgttatcgctaaattaaagactttataa

DBGET integrated database retrieval system