KEGG   Vanderwaltozyma polyspora: Kpol_1039p35Help
Entry
Kpol_1039p35      CDS       T01049                                 

Definition
(RefSeq) hypothetical protein
  KO
K00030  isocitrate dehydrogenase (NAD+) [EC:1.1.1.41]
Organism
vpo  Vanderwaltozyma polyspora
Pathway
vpo00020  Citrate cycle (TCA cycle)
vpo01100  Metabolic pathways
vpo01110  Biosynthesis of secondary metabolites
vpo01130  Biosynthesis of antibiotics
vpo01200  Carbon metabolism
vpo01210  2-Oxocarboxylic acid metabolism
vpo01230  Biosynthesis of amino acids
Module
vpo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
vpo_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:vpo00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Kpol_1039p35
Enzymes [BR:vpo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.41  isocitrate dehydrogenase (NAD+)
     Kpol_1039p35
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh
Motif
Other DBs
NCBI-GeneID: 5546564
NCBI-ProteinID: XP_001646144
UniProt: A7THG2
AA seq 359 aa AA seqDB search
MFRNLISKRAFTSIASRENIIPKKYGGRYTVTLLPGDGVGREITDSVVSIFEAENLPIDW
ERVELSGLEQEDVHTAVESLKRNKIGLKGIWHTSADHDGHTSWNVALRKELDIYANVAIF
KSFKGVDTRIPDVDLVIIRENTEGEYSGLEHESVPGVVESLKIMTAQKTERIARFAFDYA
MKYNRKSVTAVHKANIMKLGDGLFRNLVTEIGAKEYPEVGVSSIIVDNASMQAVAKPHQF
DVMVAPSMYGTILGNIGAALIGGPGLVPGANYGRDYAVFEPGSRHVGLDIENQNIANPTA
MILSATLMLNHLGFRNDAARISKAVHEVIAEGKTTTRDIGGSATTTEFTNAVIAKLKTL
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgttcagaaatttaatctcaaagagagctttcacttcaattgcttctcgtgaaaatatc
atcccaaaaaaatacggtggtcgttataccgttactttattgcctggtgatggtgtaggt
agagaaatcaccgattctgtagtctctatcttcgaagctgaaaatttgccaatcgattgg
gaaagagtagaattgtcaggtttggaacaagaagatgttcatactgccgtggaatcctta
aaacgtaacaaaatcggtttgaaaggtatatggcacacctctgctgatcatgacggtcac
acttcttggaacgtagctctaagaaaagaattggatatttacgctaacgtagctatcttc
aagtccttcaagggtgtcgatacaagaattccagatgtcgatttggttatcatcagagaa
aataccgaaggtgaatactcaggtttggaacatgaatcagtaccaggtgtagtggaatct
ttaaagatcatgactgctcaaaaaactgaaagaatcgctagattcgctttcgattatgcc
atgaaatataacagaaaatcagtcactgctgttcataaggccaatatcatgaagttaggt
gacggtttatttagaaatttggtcacagaaatcggtgctaaagaatatccagaagttggt
gtctcttctattatcgtcgataacgcctccatgcaagctgtagctaaaccacatcaattc
gacgtcatggtcgctccttcaatgtatggtactattttgggtaacattggtgctgctttg
atcggtggtccaggtttggttccaggtgctaactacggtagagattatgctgtctttgaa
ccaggttccagacacgttggtttagatattgaaaaccaaaacattgctaatccaaccgca
atgatcttatctgctactttaatgttgaatcacttgggtttcagaaacgatgcagcaaga
atctcaaaggctgtccacgaagtcatcgccgaaggtaaaactaccactagagatatcggt
ggttctgctactaccacagaattcactaacgctgttatcgctaaattaaagactttataa

DBGET integrated database retrieval system