KEGG   Vanderwaltozyma polyspora: Kpol_1041p36Help
Entry
Kpol_1041p36      CDS       T01049                                 

Definition
hypothetical protein
Orthology
K01440  
nicotinamidase [EC:3.5.1.19]
Organism
vpo  Vanderwaltozyma polyspora
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:vpo00760]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 179 aa AA seqDB search
MFSEKWDSIVLTRDWHCKDHVSFAKNHNLPNFAPFVYCSPVVNDERKIESTLWPVHCIED
TEGADIAPSLQAVLRKHPEIVLVNKGYLKDREYYSAFCDIWDDHNTELHEILQQDGIDEV
VVVGLALDYCVKNSAISAAKLGYKTTILKKYTRAIDNHKDSLRRLAKEFEYYGVILDES
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgttttctgaaaaatgggattcgatagtattaacaagagactggcattgtaaagatcat
gtatcctttgctaaaaatcataatttacctaattttgcaccttttgtctattgttcccct
gtagttaatgatgaaaggaaaatagagtcaactttatggcctgtccattgtattgaagac
actgaaggtgctgatattgctccttctttacaagctgttttaaggaagcatccagaaatc
gttttagtgaataagggctatttaaaagatagagaatattattccgcattctgtgatatt
tgggatgatcataatactgaattacatgaaattttacaacaagatgggatcgatgaagta
gtggttgttggattagcattggattattgtgtaaaaaactctgcaatttctgctgctaaa
ttaggatataaaacgactattttaaaaaaatatactcgtgcaattgataatcataaagac
tcattaagaagattagccaaagaattcgagtattatggagtaatccttgatgaaagctaa

DBGET integrated database retrieval system