KEGG   Vanderwaltozyma polyspora: Kpol_1042p1Help
Entry
Kpol_1042p1       CDS       T01049                                 

Definition
hypothetical protein
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
vpo  Vanderwaltozyma polyspora
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:vpo00600]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 653 aa AA seqDB search
MDFSSKTLKKKSSKLRKERIYSKAILIDTGILITAQPDSDSLKSTDSRRSHSHTHSRTSL
SDNHEDLINSSNLDDDDDNDDIFETASLISCVTCLSDTFSKTSNTTTTTTTTDLPYTSLK
GKFPTNTVIPYGRILHAKFIDRNRDSNMVGKIRTKSSSRKLRGSIASIDLNLSGVESNGS
SNESFARRSSIELKDYAVNRRLSNVSIGHSIFDDDYESSTNLIEITFAKPRRHDVVAKKL
LLDIDDSLLVGNGIVQEILERSYRGTKRKRKILVIINPYGGKGNAKKLFMTKCYPLLIAS
RCTVDLAYTKFSGHAITLAEALDINKYDTIACASGDGIPYEVINGLYRRKDRVEAFNKLT
ITQLPCGSGNAMSVSCHWTDNPSYATLSLVKSTETRIDIMCCSQPSYYNEHPRLSFLSQT
YGVIAESDINTEFIRWLGAARFEIGVAFNILQRKKYPCDIYVKYAAKTKNDVKTHYMNYK
NNGLPPFDIETDNIYCADDIPEVEMISEENFKLRYPFSEGIPDDWEKLDSSVTDNIGIFY
TGKMPYIAADTKFFPAALPSDGVMEMVITDGRTAVSRMVPILLALDKGTHIQQPEVLHSK
ILAYKIVPKIKNTVFAVDGEKFPLEPLQVEVLPRLCKTLLRNGRFVETEFDTI
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atggatttttcatcaaaaactttaaaaaaaaaatcttcaaaactaaggaaagaaagaatt
tacagcaaagccatcctaatagatacaggtatcttgatcactgctcaacccgatagcgac
tctttaaaatctacagattcaagacgttcgcattctcatacccattcaagaacttcctta
agtgataaccatgaagatttaataaattcatcaaatttagatgacgacgatgataatgat
gatattttcgaaactgcttcgctaatcagctgtgtcacttgtttaagtgatactttttct
aaaacttcaaataccactacaaccacaacaaccacagatttgccttatacctcattgaaa
ggtaaattcccaactaatacagtgataccttatggaagaattttacatgccaagtttatc
gacagaaacagagattcaaatatggttgggaaaatacgaacgaaatcaagtagcagaaaa
ttaagaggctctattgcttcaatagatttgaatctatctggtgtcgaaagtaacggctct
tctaacgaaagcttcgcaagacgttcaagtattgagttgaaagactatgctgtcaataga
agattgagtaatgtatcaatcggccattcaatatttgatgacgattacgaatcaagtaca
aatttaatagagataacttttgctaaaccaagaagacatgatgttgtcgctaaaaaatta
ttactagatattgatgattctttattagtaggtaatggtatcgtgcaagaaattttagag
agaagttatagaggtaccaagaggaaaaggaaaattttagtcattatcaacccatatggt
ggtaaaggaaatgccaaaaaattattcatgacaaagtgttacccacttttgatcgctagt
agatgtacagtagatctggcatatacaaaattcagcggtcatgccataactttagcagaa
gcattggacattaacaagtacgatacaatagcatgcgcctctggggatggtattccttat
gaagttatcaatggtctttatagaaggaaggatagagtagaggcattcaacaaacttacc
ataactcaattgccatgtggctccggtaacgcaatgagcgtatcctgccattggactgat
aatccatcatatgccactttatcattggttaaatccacagaaactagaattgatataatg
tgttgttcccaaccttcatattacaatgaacatcctagattatctttcttaagtcaaaca
tacggtgttattgcagaatctgatataaacacagagttcattagatggttaggagctgca
agatttgaaattggtgttgcatttaatatattgcaaagaaaaaaatatccatgcgatata
tatgtaaaatatgctgcaaagaccaaaaatgacgttaagacacattatatgaattataaa
aacaatggattacctccattcgatatcgaaacagataatatatattgtgctgatgatatc
ccagaggtagaaatgatatcagaagaaaatttcaagctaaggtatcctttcagtgagggt
attccagatgattgggaaaagttagattcttctgtcactgataatatcggtatattttat
actggtaaaatgccatatatagcggcagataccaaatttttccctgcagcattaccatct
gatggtgtaatggaaatggttattacagatggtagaactgctgtctctagaatggtccca
attttactagcattagataaaggtactcatatacagcagccagaagtattgcattcaaaa
atattagcatataaaattgttccaaaaatcaagaatactgtttttgcagttgatggtgaa
aaattccctctagaacctctacaggttgaagttttaccaagattgtgtaaaactttacta
agaaatggacgtttcgtagagacagaatttgataccatatga

DBGET integrated database retrieval system