KEGG   Vanderwaltozyma polyspora: Kpol_1045p33Help
Entry
Kpol_1045p33      CDS       T01049                                 

Definition
hypothetical protein
Orthology
K14298  
mRNA export factor
Organism
vpo  Vanderwaltozyma polyspora
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:vpo00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    Kpol_1045p33
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 361 aa AA seqDB search
MASFFSSSKTAGTSTIATDADLANDIIINNPADDSISDIAFSPQQDFLFSASSWDNKVRI
WDIQGGNPQGKAQYEHSAPVLCTRWSFDGTKVASGGCDNVVKVYDLNSGQNQQVGSHDSA
VQSLRFVQCGPTNAECLVTGSWDKTLKYWDLRQPQPISTVMMPDRVYAMDSKQQLLVVGT
AERNIVVINLTNPTTIFKTVQSPLKMQTRTVACYNSGDGYAIGSVEGRIAIRYVDEEQQR
KLGFSFKCHRQTKTNRSVGSSSQASVYAVNSISFHPGYGTFVSAGSDGSFHFWDKNQRHR
LKGYPAQNGSIPICNFNRQGSLLAYAISYDWSRGYTGNRQDYPNVIRIHPTTDAEVREKQ
K
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggcttcttttttctcatcgtcgaagacagctgggacttcaactatagcaacagatgcg
gatttagcaaatgatataataatcaataatccagcagatgattcgatttctgacattgca
ttttcaccacagcaagattttttattcagtgcaagttcttgggataataaagttcgtatt
tgggatattcaaggtggtaatccacaagggaaagcgcaatatgaacatagtgcaccagtt
ttatgtacaagatggtcatttgacggtactaaagttgcctctggtggttgtgataatgtg
gttaaagtttatgatttgaatagtggtcaaaaccaacaggttggtagtcatgattctgcg
gttcaatctttaaggtttgttcaatgtggtccaactaatgcagaatgtttagtaactgga
tcttgggataaaactttgaaatattgggatttaagacaacctcaacctatatctactgtg
atgatgccagatagagtgtatgccatggatagtaaacaacaattactagtcgttggaact
gcggaaagaaatattgtcgtaataaatttgactaatccaactacaatatttaagacagta
caatccccattaaagatgcaaacaagaactgtggcatgttataattccggtgatggttat
gctatcggttctgtggaaggtaggatagcgattagatatgttgatgaagaacagcaacgt
aaattaggtttttctttcaaatgtcatcgtcaaacaaagacaaatagatcagtgggatcc
tcttctcaagcgagtgtatatgctgtgaatagtatatcgtttcatccaggatatggtact
tttgtttcagcaggtagtgatggttctttccatttctgggataaaaatcaaagacataga
ttaaagggatacccagctcaaaatggttctattcctatttgtaacttcaatagacaaggt
agtttattagcctatgctattagttacgactggagtaggggttacactggtaatagacaa
gattatccaaacgttatcagaatacatcctacaacagacgctgaagttagagaaaaacaa
aaataa

DBGET integrated database retrieval system