KEGG   Vanderwaltozyma polyspora: Kpol_1045p50Help
Entry
Kpol_1045p50      CDS       T01049                                 

Definition
(RefSeq) hypothetical protein
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
vpo  Vanderwaltozyma polyspora
Pathway
vpo00010  Glycolysis / Gluconeogenesis
vpo00260  Glycine, serine and threonine metabolism
vpo00680  Methane metabolism
vpo01100  Metabolic pathways
vpo01110  Biosynthesis of secondary metabolites
vpo01130  Biosynthesis of antibiotics
vpo01200  Carbon metabolism
vpo01230  Biosynthesis of amino acids
Module
vpo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
vpo_M00002  Glycolysis, core module involving three-carbon compounds
vpo_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:vpo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Kpol_1045p50
  Energy metabolism
   00680 Methane metabolism
    Kpol_1045p50
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Kpol_1045p50
Enzymes [BR:vpo01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Kpol_1045p50
Membrane trafficking [BR:vpo04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Kpol_1045p50
Exosome [BR:vpo04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Kpol_1045p50
  Exosomal proteins of melanoma cells
   Kpol_1045p50
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_1 Tma16
Motif
Other DBs
NCBI-GeneID: 5546333
NCBI-ProteinID: XP_001645921
UniProt: A7TI56
AA seq 327 aa AA seqDB search
MSDSNTFKVFILRHGQSELNHENIFCGWIDAKLTEKGKLQADNSASLIQQYCNDNNQSLP
QIGYCSRLIRTQQTIQEILNQWNLTEAVQVVTGIECQYNDLNITNNDNNDKDNNDDINNN
KKNSSNGNDDKKIMPILQTWRLNERHYGSWQGQRKPQVLEEYGEKQYMYIRRGYNGKPPM
ADLDREMVQEINDKGSSTGYDFKEPNRHLKYGLEEKSGEILPNSESLADVVKRVEPFLEN
VVFRIANENNQDSCLIVAHGSSVRSILKLLQGIPDDEIKDVDIPNGIPLVIELEKKTFKF
VNKFYLDPENAKINAQKVRDEGFASNP
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgtcagattctaatacttttaaagtgtttatcctgagacatggccaaagtgaattaaat
catgaaaatatattctgtggttggattgatgcaaaattgactgaaaagggtaaattgcaa
gccgacaattctgctagtttaattcaacaatattgtaatgataataatcaatctttacca
cagattggctactgttcaagattgatacgaacccagcagactattcaagaaattttaaac
caatggaacttaactgaagcggttcaagtcgttacaggaattgaatgtcaatacaacgat
ttgaatattaccaataatgacaataatgataaagataataatgatgatattaacaacaat
aaaaaaaatagcagtaatggtaacgatgataaaaaaataatgccaattttacagacttgg
agattaaatgaaagacactatggctcttggcagggtcagagaaaaccacaagttttagaa
gaatatggtgagaagcaatatatgtacattagaagaggctacaatggtaaacctccgatg
gctgatctagacagagaaatggtacaagaaattaatgataaaggttcatccactggttac
gattttaaagaaccaaataggcacttgaaatatggtttagaagaaaaatctggtgaaata
ttaccaaattctgaatcattagctgacgtcgttaaaagagttgaaccatttttggaaaat
gtcgtttttagaattgcaaatgagaacaatcaagattcttgtctaattgttgcacatggt
tcttctgttagatctatattgaaactacttcaaggaattccagatgatgaaattaaggat
gtcgatattccaaatggtattcctttggttatagagttagaaaagaaaacttttaaattt
gttaataagttttacttggatcctgaaaatgcaaagattaatgcccaaaaagttcgtgat
gaaggttttgcatctaacccataa

DBGET integrated database retrieval system