KEGG   Vanderwaltozyma polyspora: Kpol_1048p27Help
Entry
Kpol_1048p27      CDS       T01049                                 

Definition
(RefSeq) hypothetical protein
  KO
K01476  arginase [EC:3.5.3.1]
Organism
vpo  Vanderwaltozyma polyspora
Pathway
vpo00220  Arginine biosynthesis
vpo00330  Arginine and proline metabolism
vpo01100  Metabolic pathways
vpo01110  Biosynthesis of secondary metabolites
vpo01130  Biosynthesis of antibiotics
vpo01230  Biosynthesis of amino acids
Module
vpo_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:vpo00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    Kpol_1048p27
   00330 Arginine and proline metabolism
    Kpol_1048p27
Enzymes [BR:vpo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Kpol_1048p27
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-GeneID: 5546897
NCBI-ProteinID: XP_001646455
UniProt: A7TGJ0
AA seq 319 aa AA seqDB search
MEAPHYKFLNERKVSLVLAPFSGGQKKQGVEKGPQYMLKHGLESNLNELGWETKLLDPLQ
GLDVELQDDSDDIKGSNIKNSKSVGVATQLIHNSVKETLNDNRFPLTLGGDHSIAMGTVS
AVVEKYPNAGVLWIDAHADINTVDSTESGNLHGCPVSFLMGLNPEEKIPSSLKWLPKNLK
PNKIAYIGLRDLDDAEKKILKDLNISAFSMYHVDRYGINKVIEMAIESISTSENDPIMCS
YDVDAVDPLYVPATGTPVRGGLTLREGLFIVERLAETGRLVALDVVECNPDLSHNDIHVV
DTISAGCAIARCALGETLL
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggaggctcctcattataagtttttgaatgaacgtaaagtttcattggtattagcacca
ttctccggtggtcagaagaaacaaggtgtcgaaaaaggcccacaatacatgctaaaacat
ggtttggaatccaatttgaacgaattgggttgggaaactaaactgctagatcctttgcaa
ggtcttgatgtcgaattacaagacgattcggatgacatcaaaggttcaaatattaaaaat
tcaaaatctgtaggtgtcgctactcaattaattcataattctgtcaaagaaactttaaat
gataataggttcccattgactttgggtggtgaccattctattgcaatgggtaccgtctct
gctgtggttgaaaaatatccaaatgctggggttttatggatcgatgctcatgcagatatt
aataccgttgattcaacagaatctgggaacttacacggttgcccagtttctttcctaatg
ggcttgaacccagaggagaagatcccttcttcattgaaatggttaccaaaaaatttaaaa
ccaaataaaattgcttacattggtttaagagatttggatgatgctgagaaaaaaatctta
aaagatttgaacatatctgctttctcaatgtaccatgtcgatagatatggtatcaataaa
gtcattgaaatggctatagaatcaatttccacttctgaaaatgatcccatcatgtgttct
tatgatgtcgatgcagtagatccattatacgtgcctgcaactggtacgcctgtgagaggt
ggtttgaccttaagagaaggtttgttcatcgtagaaagattggctgaaacaggtagacta
gtagctttagatgtagtagaatgtaacccagatttatcccacaacgatattcatgttgta
gatactatttcagctggttgcgcaattgctcggtgtgccttgggtgaaacattgttgtaa

DBGET integrated database retrieval system