KEGG   Vanderwaltozyma polyspora: Kpol_1050p72Help
Entry
Kpol_1050p72      CDS       T01049                                 

Definition
(RefSeq) hypothetical protein
  KO
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
vpo  Vanderwaltozyma polyspora
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:vpo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Kpol_1050p72
   01230 Biosynthesis of amino acids
    Kpol_1050p72
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Kpol_1050p72
   00030 Pentose phosphate pathway
    Kpol_1050p72
   00051 Fructose and mannose metabolism
    Kpol_1050p72
   00052 Galactose metabolism
    Kpol_1050p72
  Energy metabolism
   00680 Methane metabolism
    Kpol_1050p72
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Kpol_1050p72
Enzymes [BR:vpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Kpol_1050p72
Protein phosphatases and associated proteins [BR:vpo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Kpol_1050p72
Messenger RNA biogenesis [BR:vpo03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Kpol_1050p72
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 989 aa AA seqDB search
MQSPNICYGVAFRSLATADNDLFHQTVKFYHSLGFSTIKDFDKFRHGQNSLLASGTSDGS
MKEVWLEAFKLSEVDESGFRIPQQEASNRHQSQGALLKLRLIMDRESHHADIIKTPVTSS
ITYFSTELDQILSTFSNAVKISDSLVSLVDPLGNEIYFSSFANANDTQPTDKKYYLNPSP
EELAKDKIALEAATILKQSVSTNGIKKKLAVMTSGGDSPGMNAAVRAVVRAGIHYGCDVY
AVYEGYEGLLRGGQYLKKMEWEDVRGWLSEGGTLIGTARSLDFRQRWGRKQAAGNLISEG
IDALIVCGGDGSLTGADLFRHEWPSLVEELVKDGKFTQEQVEPYKNLTIVGLVGSIDNDM
SGTDSTIGAYSSLERISEMVDYIDATAKSHSRAFVVEVMGRHCGWLALMAGIATGADYIF
IPERASPKGKWEDDLKEVCKRHKSKGRRNITVIVAEGALDNELNPITAEDVKNVLVELGL
DTRVTILGHVQRGGTAVAHDRWLATLQGVDAVKAVLENTPETPSPLIGINENKIVRMPLV
ESVKLTGSVATAIAAKDFDKAISLRDPEFIELYENFLSTTVRDDGSELLPEDKRLNIGIV
HVGAPSAALNAATRAATLYCLSHGHKPVAILNGFSGLIQTGEVKELSWLDVENWHNLGGS
EIGTNRSVAAEDMGTIAYYFQKNKLDGLIILGGFEGFRSLKQLRDAREKYPIFNIPLVLI
PSTVSNNVPGTEYSLGVDTCLNALVQYTDEIKQSASASRRRVFVVEVQGGHSGYIATFTG
LVTGAVSVYTPEDKINLASIQEDIALLKENFSHDKGENRNGKILIRNEEASSVYSTDMIS
DIISEASSKKFGVRTAIPGHFQQGGSPSSKDRVIASRFAVRCIKFIEQWNERNQKTGENI
DSKVLRFTFNDQAEKIPTVEHEDDSAAVICVNGSAISFKPVAELWENETNVALRKGHEVH
WTEFKEINDVLSGRIRLRAEIAESANESQ
NT seq 2970 nt NT seq  +upstreamnt  +downstreamnt
atgcaatctccaaatatctgctatggtgtggcatttagatcattagctactgctgataat
gatttatttcaccaaaccgttaaattttatcattctctaggtttctctacaattaaagat
ttcgacaaatttagacatggccaaaactctttgttagcctctggtacttcagatggttca
atgaaggaagtttggttggaagccttcaaattaagcgaagtcgatgaatcaggtttcaga
atccctcaacaagaagcatcaaacagacaccaaagtcaaggtgctttgttgaagttgcgt
ttgattatggacagagaatctcatcacgctgatatcattaaaactccagttacttcatca
attacctacttctctaccgaattagaccaaatcttgtccactttctcaaatgccgtcaag
atttctgactctttggtctctttggtcgacccattgggcaacgaaatttacttctcttct
tttgctaatgccaacgatacccaaccaactgataagaaatactatttgaacccatctcca
gaagaattagctaaagacaaaattgctttagaagctgctaccatcttgaaacaatctgtc
tctactaatggtatcaagaagaagcttgctgttatgacctctggtggtgattccccaggt
atgaatgctgctgttcgtgctgtcgtcagagcaggtatccactacggttgtgacgtttac
gctgtttacgaaggttacgaaggtttgctaagaggtggtcaatatttgaagaagatggaa
tgggaagacgtcagaggttggttaagtgaaggtggtactttaatcggtactgctcgttcc
ctagatttcagacaacgttggggtcgtaaacaagccgctggaaacttgatttctgaaggt
atcgatgctcttatcgtctgtggtggtgacggttctttaactggtgccgatttattcaga
catgaatggccatctttagtcgaagagttagttaaagatggtaaattcacccaagaacaa
gtcgaaccatacaagaacttgaccattgttggtttagtcggttccatcgataacgatatg
tctggtactgattctaccattggtgcttactcttctttagaaagaatctctgaaatggtt
gactacatcgatgctacagctaaatctcactccagagctttcgttgttgaagtcatgggt
agacactgtggttggttagctttaatggctggtatcgctactggtgctgattatatcttc
attccagaaagagcttctccaaagggtaagtgggaagatgacttaaaggaagtttgtaag
agacacaagagtaaaggtagaagaaacatcacagtcattgtcgctgaaggtgctttagat
aacgaattgaacccaattactgctgaagatgttaagaacgtcttagtcgaattaggtttg
gataccagagttactatcttgggtcacgtccaaagaggtggtactgctgtcgctcatgat
agatggttagctactttacaaggtgttgatgctgttaaggctgttttggaaaacacacca
gaaactccatctccattgatcggtattaacgaaaacaagattgtcagaatgcctttagtc
gaatctgtcaagttgactggttccgttgctactgctattgctgccaaggacttcgacaaa
gccatttctttaagagacccagaattcattgaattatacgaaaatttcttatccactact
gtcagggatgatggttctgaattgttaccagaagataagagattgaacatcggtatcgtc
catgtcggcgctccatctgctgctttgaacgctgctacccgtgctgccaccctatactgt
ttgtctcatggtcacaaaccagttgctatcttgaatggtttcagtggtttaattcaaact
ggtgaagttaaggaattatcctggttagatgttgaaaactggcacaatttgggtggttcc
gaaattggtaccaacagatctgttgctgctgaagacatgggtaccattgcatactatttc
caaaagaacaagttggatggtttaatcatcttaggtggtttcgaaggtttcagatctttg
aaacaattacgtgatgctagagaaaaatacccaatcttcaacattccattagtattgatc
ccatcaaccgtttctaacaacgttccaggtactgaatactctttaggtgttgatacctgt
ttgaatgctttagtccagtacactgatgaaattaaacaatctgcctctgctagtagaaga
agagttttcgttgttgaagttcaaggtggtcactctggttacattgctactttcaccgga
ttggttactggtgccgtctccgtttacacaccagaagacaagatcaacttggcatccatc
caagaagatattgccttattgaaggaaaacttctcccacgataaaggtgaaaaccgtaac
ggtaagattttgatcagaaatgaagaagcctcatctgtatacagcactgatatgatttca
gatatcatcagtgaagcctcctccaagaagttcggtgtcagaaccgctattccaggtcac
ttccaacaaggtggttctccatcttctaaagatcgtgttatcgcttctcgttttgctgtc
agatgtatcaaatttattgaacaatggaatgaaagaaaccaaaagactggtgaaaacatt
gattctaaggttttgagatttacattcaacgaccaagccgaaaaaataccaactgtagaa
cacgaagatgactcagctgctgtcatctgtgtcaacggttccgctatctctttcaagcca
gttgctgaattatgggaaaacgaaaccaatgttgcattgagaaagggtcatgaagttcac
tggactgaattcaaggaaattaacgatgttctatccggtagaatcagattaagagctgaa
atcgccgaatctgctaacgaatcccaataa

DBGET integrated database retrieval system