KEGG   Vanderwaltozyma polyspora: Kpol_1051p8Help
Entry
Kpol_1051p8       CDS       T01049                                 

Definition
hypothetical protein
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
vpo  Vanderwaltozyma polyspora
Brite
Enzymes [BR:vpo01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     Kpol_1051p8
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 683 aa AA seqDB search
MNSTDIVVFGLLAVGLFAYFKRETLKELLSSDDSDIAVTTGGSRDIAQIVRDNNKNYLVL
FASQTGTAEDYAKKFAKELAAKFSLNVMCGDVENYDFETLNELPENCIVSIFISTYGEGD
FPDGAINFEEFLSNAADVNSLPNVNFTLFGLGNSTYEFYNGAAGKALKHLEAAGASIIGP
YGQGDDGAGTTDEDYMSWKDAVMELLKDQLKLDEHEQTFTPSFKYEPLSSISEETSLGEP
SFQYLPVGKLSFNDAHIQLGPYDLSHPFVAPIVKSNELFTSADRNCIHSEIDISGSNMKY
STGDHLGIWPSNANEKVEQFLSTFGLDSNTIFDLKPLDSTVKLPFPVPTTIGAAVRNYME
ITGPVPRNLFASLVQFAPNDELKEKLTSLSQDKDLFAKEVTAKYLNLADALLQLSNGEKW
STVPWEFLIEAIPHLNPRYYSISSSALSEKQVIHITSVVENSENPTGSGPRVLGVATNLL
RNIELVENKEDESTLPIHYDLTGPRKLFSGFKLPVHVRRSTFRLPTNPSTPVLMIGPGTG
VAPFRGFIRERVAYVQTQENVKLGKHLLFYGSRDTHDYLYKEEWPEYSKKLDGSFEMVVC
HSRLPNVKKVYVQDKLRERASDVYQMIKDGAFIYVCGDAGSMAKGVSSALVDILSKEQSI
STEDACEMIKMLKTSGRYQEDIW
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atgaattctactgatatagtagtattcggtttacttgccgttggtttgtttgcttatttc
aaaagagaaactttgaaagaacttttaagctctgatgatagcgatattgctgtaactact
ggtggttcaagagatattgcccaaattgttcgtgataataataaaaattatctagtttta
ttcgcttcccaaactggtactgctgaagattatgcaaagaaatttgcaaaagagttagct
gcaaaattctctctaaatgttatgtgtggtgatgttgaaaattatgatttcgaaactttg
aatgaattaccagaaaattgtattgtttcaatctttatctctacttatggtgaaggtgat
ttccctgatggtgctattaacttcgaagaatttttatcaaacgctgccgatgtcaattct
ttgccaaatgtcaatttcactttatttggtctaggtaactctacttatgaattttacaat
ggtgctgctggtaaagctttgaaacatttagaagcagccggtgcttctataatcggtcct
tacggccaaggtgacgatggtgctggtactactgatgaagattatatgtcctggaaagat
gctgtcatggaattattgaaagatcaattaaaattagatgaacatgaacaaacttttacc
ccatcatttaaatacgaacctttatcttccatttctgaagaaacctcccttggtgaacct
tctttccaatacttgccagtcggtaaattgtccttcaacgatgctcacatccaattaggt
ccttacgatttatcccatccatttgttgctccaattgttaaatctaatgaattattcact
tctgctgaccgtaactgtattcactccgaaattgatatctctggctctaatatgaaatat
tctactggtgatcatttaggtatttggccatccaatgctaatgaaaaagtcgaacaattt
ttgtctactttcggcttagattcaaacactatctttgatttgaaacctttagattctact
gttaaattacctttccctgtcccaactactatcggtgctgctgtcagaaactatatggaa
attactggtcctgtcccaagaaacttatttgcttctttagttcaatttgctccaaatgat
gaattgaaggaaaaattaactagcttgtctcaagataaagatttgttcgcaaaagaagtt
actgctaaatacttaaatttggcagatgctttgttgcaattgtctaatggtgaaaaatgg
tctactgttccatgggaattcttgattgaagctatccctcatttaaatccacgttactat
tccatctcttcttctgcgttatctgaaaaacaagttatccatatcacttctgttgttgaa
aattctgaaaatccaactggttctggtccaagagtattgggtgttgctaccaacttgtta
agaaatatcgaattagttgaaaacaaagaagatgaatctactttacctatccattatgat
ctaactggtcctcgtaaattattctctggtttcaaattacctgtccatgttcgtcgttcc
actttcagattaccaaccaacccatccactcctgttttgatgattggtccaggtactggt
gttgctccattccgtggttttattagagaacgtgttgcctatgttcaaactcaagaaaac
gttaaactaggtaaacatttattattctacggttctcgtgatactcatgattatttgtat
aaggaagaatggccagaatattccaagaaattggatggttcattcgaaatggttgtttgt
cactccagattaccaaacgtaaagaaggtttatgttcaagataagctaagagaacgtgct
agtgatgtttatcaaatgatcaaggatggtgcctttatctacgtttgtggtgatgctggt
agtatggctaaaggtgtgagttccgctttggttgacattttatctaaagaacaatccatc
tctactgaagatgcttgtgaaatgataaagatgttaaagacttccggcagatatcaagaa
gatatttggtag

DBGET integrated database retrieval system