KEGG   Vanderwaltozyma polyspora: Kpol_1052p36Help
Entry
Kpol_1052p36      CDS       T01049                                 

Definition
hypothetical protein
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
vpo  Vanderwaltozyma polyspora
Brite
Protein phosphatases and associated proteins [BR:vpo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     Kpol_1052p36
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 175 aa AA seqDB search
MGAASSKLIDSLLEDTNFDRDEIERLRKRFMKLDSDSSGSIDKNEFMSIPGVSSNPLAGR
IMEVFDADNSGDVDFQEFITGLSIFSGRGSKDEKLKFAFKIYDIDKDGYISNGELFIVLK
IMVGNNLDDAQLQQVVDRAIIENDVDGDGRLSFEEFKNAIETTEVAKSLTLQYNV
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgggtgctgcatcatcaaaacttatagacagcttactggaggataccaattttgatcga
gatgagattgaaaggttaagaaaaagatttatgaaactagatagcgatagctcaggtagt
attgataaaaatgaatttatgagtattccaggtgtttcatcaaaccctttagctggaaga
attatggaggtatttgatgcggataatagtggagatgttgattttcaagaatttatcact
ggtctatctatttttagtggtaggggtagtaaggatgaaaaattaaagtttgcctttaaa
atatatgatatcgacaaagatggttatatatctaatggtgaattgtttattgtgttgaaa
attatggttggtaataatttggatgatgcccaattgcaacaggttgttgatagagcaata
atagaaaatgatgtagatggagacggtcgcttaagttttgaagaatttaagaatgctatt
gaaactacagaggtagcaaaaagtttaactttacagtataatgtttaa

DBGET integrated database retrieval system