KEGG   Vanderwaltozyma polyspora: Kpol_1054p51Help
Entry
Kpol_1054p51      CDS       T01049                                 

Definition
(RefSeq) hypothetical protein
Organism
vpo  Vanderwaltozyma polyspora
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 462 aa AA seqDB search
MLSLRKKAESRRHNRKKLNPNIHLDDEISTAEAVDGVTSAAGNDTRAASGADGDGKGFSE
SDPSMADLETTFATFNVIFDKLRSPSNQERLQASYELKNSLISLAREVSTEQFQRFSNVL
NNKIFELIHGSDVNEKIGGILAVDTLIGFYVHTEELPNQTSRLANYLRVLIPSNDIEVMR
LAATTLGKLAIPGGTLTSDFVEFEVKTCIEWLTTSPENSSSSSKQEFRKHASLLIVTALA
NNSPYLLYPYINSILDNIWRALRDTKLVIRSDAAVTLGKCLSIIQHRDSILTKQWYERLF
KGCVYGLTLNTNEAIHATLLVYRELLVLRGSFLNSKYDEIYHSTMKYKDHKYDVIRKEVY
AILPLLASFEPQIFTNKYLDQTMVHFLMVLKNLNASSANLSDKSYILVSIGDIAFEVGSN
ITPYMDPILDNIRDGLQSKFKNRKNFERELFYCIGKLASAVG
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgttatcccttaggaagaaagcagaaagtcgtcgccataataggaagaagttaaatccg
aatatacatcttgatgatgaaatatctacagcagaagctgtagatggtgttacttcagct
gctggaaatgatactagggctgctagtggtgccgatggtgatggtaaaggtttcagtgaa
tcggatccatccatggctgatttagaaactacgtttgcaacctttaatgtgatttttgat
aagctaagaagtccatctaatcaagaacgattacaggcatcctacgaattaaagaattct
ctcatttctctagcgcgtgaggtttcaactgaacagttccaaagatttagtaatgtgtta
aataataaaatattcgagttaattcacggatctgatgtcaatgaaaaaattggtggtatt
ttagctgtagatactttgattggattttatgtacatacagaagaactaccaaatcaaact
tcaagattagctaattatcttcgtgttttgatcccttccaatgatattgaagtaatgcgt
ttagcggcaactaccttaggtaaattagccatccctggtggtaccttaacttcggatttt
gtcgaattcgaggttaaaacatgtattgaatggctaacaacctcgccagaaaattcttcc
tccagttcgaagcaagaattcagaaaacatgcatctttattaattgtaacagcattggca
aataattctccatatttattatatccttacattaattctattttagacaatatttggaga
gcattaagagatacaaaattggttatcagatcggatgcagctgtaaccctaggtaaatgt
ttatcaattatccaacatagagattcaattttaacaaagcagtggtacgaacgtttattt
aaaggttgtgtctatggactaactttaaatacaaatgaagctattcatgcgactttactg
gtttatagggaattgttagtactacgaggttcctttttaaactcaaaatacgatgaaata
taccactctacaatgaaatataaagaccataaatatgatgttatcagaaaagaagtatat
gctattcttccgctactggcatcatttgagccccaaatttttaccaataaatatctagat
caaacaatggttcattttttaatggtattaaagaatttaaatgcaagcagtgccaaccta
tcagacaaatcgtatatattggtttcaattggtgatattgcattcgaggtaggatcaaat
ataaccccgtatatggatcccattctagataatataagagatggattgcaatctaaattc
aaaaatcgtaaaaattttgaacgcgaactgttttattgtattggcaaactagcttctgca
gtaggc

DBGET integrated database retrieval system