KEGG   Vanderwaltozyma polyspora: Kpol_1058p45Help
Entry
Kpol_1058p45      CDS       T01049                                 

Definition
hypothetical protein
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
vpo  Vanderwaltozyma polyspora
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 389 aa AA seqDB search
MSISDFKPELWTTSSNNALKISLVGENAVQFSPTFTYPIFGDSEQIFGYQDLVIHLVFDS
VTFKPFMNVKYSKKIDNEADDIQGKLLKFLPKDDIIVKDEEKWVDAFEEEQKSYKFLNDE
FKIGEYSIGDDEFVVYKAGIKDKFINKFHQRIQIFSLLLIEAASYIDDSDPNWELVLSFN
KKTKQCVGFVTVYKYWKYEGFKEFDNDDNSHYRGKISQFLVFPPYQGKGHGSNLYQSIYN
TWKNDSSITELVVEDPNEDFDDLRDRTDLEMLQKELFFNSVPNSGLVEEAWIKKQMKKYK
IEARQFHRLIEMIMLHKNYNNFNIQVKKRLFLKNYDALIEMEESERNDALDKSVESLEED
YKRILSLCKFGKRDPSFDDEKHRNKKVKL
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatttctgattttaaaccggaactatggacaacttcttctaataatgcattaaag
atttcattagttggcgaaaatgctgttcaattttcacctacctttacatatccaatattt
ggtgattctgaacaaatattcggttatcaagatttggttatacatttagtctttgattct
gttacatttaaaccttttatgaatgtaaaatattctaaaaaaattgataacgaagctgat
gatattcaagggaaattattaaagttcttaccgaaagatgatattattgttaaagatgaa
gagaaatgggtagacgcctttgaagaagaacaaaaatcttataagtttttaaatgatgaa
tttaaaattggagagtattctataggagacgatgaatttgttgtttataaagccggtatc
aaagataaatttattaataaatttcatcaacgtattcaaatcttttctttattattaatc
gaagcagcatcatatatcgatgactctgatccaaattgggaattagttttatcttttaat
aagaaaactaaacagtgtgttggatttgtaactgtttataaatattggaaatatgaaggc
ttcaaagaatttgacaatgatgataattcacattatagaggaaaaatatcccaattccta
gtattcccaccttatcaaggtaaaggccatggttctaatctgtatcaatcaatttataac
acttggaaaaatgattcatcaattactgaacttgttgttgaagatccaaatgaagatttt
gatgacttgagagatcgtactgacttagaaatgttacaaaaagaattatttttcaattct
gtaccaaattctggacttgttgaagaagcttggataaaaaaacaaatgaagaaatataaa
attgaagcaaggcaattccatcgcttaattgaaatgattatgctccataagaactacaat
aattttaacattcaggtgaaaaagaggcttttcttaaagaactacgatgctctaatcgaa
atggaagaatctgaaagaaacgatgcattagataaatcagtagagtcattggaagaagat
tacaagagaatcctatctttatgtaaatttggtaagagagacccttcctttgatgatgaa
aaacatagaaacaaaaaagtaaaactctag

DBGET integrated database retrieval system