KEGG   Vanderwaltozyma polyspora: Kpol_1059p19Help
Entry
Kpol_1059p19      CDS       T01049                                 

Definition
(RefSeq) hypothetical protein
  KO
K08738  cytochrome c
Organism
vpo  Vanderwaltozyma polyspora
Pathway
vpo01100  Metabolic pathways
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550 CCP_MauG
Motif
Other DBs
NCBI-GeneID: 5544459
NCBI-ProteinID: XP_001644187
UniProt: A7TN23
AA seq 108 aa AA seqDB search
MAYTPGSEKKGATLFKTRCLQCHTVEAGGPNKVGPNLHGVFGRQTGSAAGYSYTDANIKK
GIVWDENNMSDYLINPKKYIPGTKMAFGGLKKEKDRNDLIAYLVKACK
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atggcttatactccaggcagtgaaaagaaaggtgctaccttattcaagactagatgtttg
caatgtcacaccgttgaagctggtggtccaaacaaggtcggtccaaatttacatggtgtc
tttggtagacaaaccggttctgccgcaggttactcttacactgatgctaacatcaagaag
ggtatcgtttgggatgaaaacaacatgtctgattatttgatcaacccaaagaaatatatc
ccaggtaccaagatggctttcggtggtttgaagaaggaaaaggacagaaacgatttgatc
gcttacttagttaaggcttgtaaataa

DBGET integrated database retrieval system