KEGG   Vanderwaltozyma polyspora: Kpol_1060p53Help
Entry
Kpol_1060p53      CDS       T01049                                 

Definition
hypothetical protein
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
vpo  Vanderwaltozyma polyspora
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 736 aa AA seqDB search
MQGEVMSNNRPFDNGNHNGNSNNNEEKKDFWNPAFMTQQRGFQQQQQQQPQQSALNSDID
PGMRPGQFIFNNPWRNDPASRKNSLAASPFPDNSMGMLDIDYRRRKSSLVTPPSRTANTN
PFQSDKAANFPQSTAAYQQQRQFLANDNGMFADRLGPSMNFVDPNDFYRRQSVAAVSYQP
DTGPTITANQSIPITHYRRLSAYPQSMTPSLHPIRREEPLVKQQPIHIPQMHITNSANDL
QPLINPTPDYRRASLNSKEISPLNALTTGLITTYSLCSPDFAYKTSKNPKRVLTKPNEPR
GNNGFDNVNSDYILYVNDVLGTEQNRKYLVLDILGQGTFGQVVKCQNVMTKEIVAVKVVK
SRSEYVNQSISEVKILELIQKKIDPNDEHHFLRLYDTFVHKNHLCLVFELLSNNLYELLK
QNQFHGLRIPLIRTFTKQLLDSLTVLKSSKLVHCDLKPENITLCAPDKPDIKVIDFGSSC
EETRTLYTYIQSRFYRAPEIILGIPYSTSIDMWSLGCIVAELFLGIPIFPGASEFNQLTR
IVNALGYPPTWMIERGKNSKKYLVPVDSHQNNDVLINIDSNMNQPHIAQVQPPKYRLKTV
DEFNMEFHATEAPSKRYFKFEKLEEIIKNYRISKKVQSSPQLLEREMRERECLIHFLNGI
LNINPFERWTPQQAAMHPFITEQPFTGEWYPYNSFSMATPPDENGHNMHQLDNTENSAWK
DPTAKDFDKLSINDKA
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atgcaaggagaggttatgtcaaacaatcggccatttgataatggcaatcataatggaaat
tctaataataatgaggaaaagaaagatttctggaatccagcatttatgacgcaacagcgt
ggatttcagcaacagcaacaacaacaaccacagcaatctgcgttgaatagtgatatcgat
ccaggtatgcgtccaggtcaatttattttcaataatccttggcgaaatgacccagcatcc
aggaaaaacagtcttgccgccagtccttttccagataattctatgggaatgttagatata
gattatagaagaagaaaatctagtttggttacaccaccatcaagaacagctaacaccaat
ccatttcaatctgataaagctgccaattttcctcaatctactgcagcatatcagcaacaa
agacaattccttgccaatgacaatggtatgtttgcggataggttgggaccatccatgaac
tttgttgatccaaatgacttttacagaagacagagtgttgccgcggtctcatatcaaccc
gatactggtccaacaataactgcaaatcaatctattcctataacgcattatagacgttta
agtgcctatccacagtcaatgacgccaagtttgcatccaattagaagggaagagccatta
gtgaaacaacaaccaattcatatccctcaaatgcatatcacaaattctgcaaacgatcta
caacccctgattaatccaacacccgattatagaagagcatctctaaattcaaaggaaata
tcgccattgaatgccttgacaacagggttaatcacaacttattccttgtgttctccagat
tttgcttataaaacatccaagaatccaaagagagtgcttacaaaaccaaatgaaccaaga
ggcaataatggctttgataatgtcaatagtgattatattctttatgtcaatgatgttcta
ggtactgagcaaaacagaaaatacttagttttagatattcttggtcaaggtacatttggt
caagttgtaaaatgtcaaaatgttatgacaaaggaaattgtagctgttaaagtggttaaa
tcaagatcagagtatgttaaccaaagtatatcagaagttaaaattttagaattgatccaa
aagaaaattgatccaaatgatgaacatcatttcctaagattgtatgatacatttgtgcat
aaaaatcatttgtgtttggtttttgaattgttaagtaataatctatatgagttactaaaa
caaaatcaatttcacggtttaaggattccattgataagaacttttacaaaacaattacta
gattcattaacagtattaaaatcaagcaagttggtacattgtgatctgaagccagaaaat
attactctatgtgcaccagataaaccagatatcaaggtcattgattttggttcttcatgt
gaggaaacaagaactctatatacgtatattcaatcaagattctatcgtgcgccagaaatt
attttgggtatcccatattctactagtattgatatgtggtcattaggctgtattgtagcc
gaattatttttaggtatccctatcttcccgggagcttcagaatttaaccaactaacgaga
attgtaaatgcattaggatacccaccaacctggatgatagaaagaggtaaaaactctaaa
aaatacctggttccagtagattctcatcagaacaacgatgtgttaataaatattgattct
aacatgaatcaaccacatatagcacaagtacagccaccaaaatacagattaaagactgtt
gatgaatttaatatggaattccatgctactgaagctccaagcaaaagatattttaagttt
gaaaaattggaggagattatcaaaaactatagaatttcgaagaaggtccagagttcaccg
cagttattagaaagggaaatgcgtgaacgtgaatgtttaatccatttcttaaatggtata
ttgaatattaatccatttgaaagatggactccacaacaggcagccatgcatccatttata
acggaacaaccatttactggtgagtggtatccatataactcattttcgatggctacacca
ccagacgaaaatggtcacaacatgcatcaattggataatactgaaaactcagcttggaaa
gatccaacagcaaaagatttcgataaattaagtattaacgataaggcttaa

DBGET integrated database retrieval system