KEGG   Vanderwaltozyma polyspora: Kpol_1062p27Help
Entry
Kpol_1062p27      CDS       T01049                                 

Definition
hypothetical protein
Orthology
K05759  
profilin
Organism
vpo  Vanderwaltozyma polyspora
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 126 aa AA seqDB search
MSWQAYTDNLLATGKIDKAVLYSRAGDAVWASSGGLALAATEISGIAQGFDDPSHLQSNG
LHIQGQKFMMLRADDRSIYGRHDAEGVVCVRTKQTILVAHYPATVQAGEATKIVEQLADY
LISVQY
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgtcttggcaagcttacactgataacttattggctactggtaaaattgacaaagccgtt
ttgtactcaagagcaggtgatgctgtttgggcttcatctggtggattagccttggctgct
accgaaatttctggtattgctcaaggttttgatgatccttctcacttacaaagcaatggt
ttgcatattcaaggtcaaaaatttatgatgttaagagctgatgatagaagtatttatggt
agacacgatgccgaaggtgttgtttgtgtcagaactaaacaaactatcttggttgctcat
tatcctgctactgttcaagctggtgaagctaccaaaatcgtagaacaattagctgattac
ttgatcagtgtccaatactga

DBGET integrated database retrieval system