KEGG   Vanderwaltozyma polyspora: Kpol_1062p3Help
Entry
Kpol_1062p3       CDS       T01049                                 

Definition
hypothetical protein
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
vpo  Vanderwaltozyma polyspora
Brite
Enzymes [BR:vpo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Kpol_1062p3
Transcription machinery [BR:vpo03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     Kpol_1062p3
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 566 aa AA seqDB search
MAGRRRSHRRHGGGLAKGPLNKKMKLEARESKDKSEATKEKSGQDLKKDKEESAVQDEVA
LEEEPKEDNNGNTNSDAETTAIKEDTDVKYKDLESSFEEEVEEEERKENIGEKDERKEED
KKSDDDRLEMNIDSTKDVDKEETIENKQETETPVQENERTKNNEDESDSDSKNTNENNAN
KSEVEESGSISESIEIEEKGITTFTFDGVEYKFKERPSVIEEKEGKIEFRVVNNDNTKEN
MMVLTGLKNIFQKQLPKMPKEYIARLVYDRSHLSMAVVRKPLTVVGGITYRPFDSRGFAE
IVFCAISSTEQVRGYGAHLMNHLKDYVRNTSPIKYFLTYADNYAIGYFKKQGFTKEITLE
KQVWMGYIKDYEGGTLMQCSMLPRIRYLDAPKILLLQEAALIRKIRSISKSHIVRPGLDQ
FRDLDNIKPIDPMSIPGLKEAGWTPEMDELAQRPKRGPHYAAMQNILTELQNHAAAWPFL
QPVNKEEVPDYYEFIKEPMDLSTMEVKLESNRYDKMEDFIYDARLIFNNCRKYNGENTSY
YKYANRLEKFFNSKIKEVPEYSHLVE
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atggcgggaagacgcagaagccatagaagacatggaggtggtctagcaaagggaccttta
aacaagaagatgaaattagaagcaagagaaagcaaggataagtctgaagccactaaggaa
aaatcagggcaagatctcaaaaaagataaggaagaaagcgctgttcaagatgaagtagca
ttagaagaagaaccaaaagaagataacaatgggaatacaaatagcgatgctgaaacaacg
gctataaaagaagatacagatgttaagtataaagatctggagtcatcatttgaggaagag
gttgaagaagaagaaaggaaggaaaatattggtgagaaggatgagagaaaggaagaagat
aaaaagtcagatgacgatagattggaaatgaatattgattctacaaaagatgttgataaa
gaagaaacaatagagaataagcaagaaacagagactccagtacaagaaaatgaaagaact
aaaaataatgaagatgaatctgattctgatagtaaaaacactaatgagaacaatgccaat
aaatccgaagtagaagaatccggaagtatatctgaaagcatagaaattgaagaaaaaggc
ataactacatttacatttgatggagtagagtataagtttaaagagagacctagtgtcatt
gaagaaaaagaaggtaaaattgaattcagagttgttaacaatgataatacaaaggaaaat
atgatggttctaactggtttaaaaaatattttccaaaaacaattaccaaaaatgccaaaa
gaatatattgcaagattagtgtacgatcgaagtcatttgtcaatggcagtggttaggaaa
ccgttaactgttgttggtggtatcacctatcgtccatttgatagtcgaggttttgctgaa
attgttttctgtgctattagttcaacagaacaagtcagaggttatggtgctcatctaatg
aatcatttgaaggattatgtacgaaacacttcgcctataaagtactttctaacttatgct
gataattatgccattggttatttcaagaagcagggttttaccaaagagattactttagaa
aaacaagtttggatggggtatataaaagattatgaaggaggtacactaatgcaatgttca
atgctaccacgtatacgatacttagatgctcccaaaattttgctactacaagaagcagca
ctaattaggaaaataaggtcaatatcaaaatcgcatatcgtaagaccaggtttagatcaa
tttagagatcttgacaacataaagccaatagatcctatgtcgatccctggtttgaaagaa
gcaggatggacaccagaaatggatgaattggcacaaaggcccaagagaggtcctcattat
gcagcaatgcaaaatatattgacagaattacaaaaccacgctgctgcatggccattttta
cagcctgttaataaagaagaagttccagactattatgaattcattaaggagcctatggac
ttaagtactatggaggtcaaattagaaagcaacagatacgacaagatggaagactttatt
tatgatgcgaggttaattttcaataattgtcgtaaatataatggtgaaaacacttcctat
tataaatacgctaatagactagagaaattttttaattcaaaaataaaggaagtgcctgag
tactcacatcttgtagaataa

DBGET integrated database retrieval system