KEGG   Vanderwaltozyma polyspora: Kpol_1062p59Help
Entry
Kpol_1062p59      CDS       T01049                                 

Definition
hypothetical protein
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
vpo  Vanderwaltozyma polyspora
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:vpo00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 534 aa AA seqDB search
MINSIAKVKCNGSVGVIGSGVSGLTFAYFLNKLRPDLRITILDNQHKNGGWLYSYTFKDE
NDNGKEVMVEKGPRTLRGASPGTAIIIDTFEKMGQIEKVQTIESNCTANRKFLLSTNDKL
VQVPNKLFSMNTFNLLFKDPLGKNVLSSVLFEPFRKSKPLTKDETVHEFLSRRFGPSNAI
SNNFLSAIYHGIYADDIKKISLEKTNPAFYNLEKQHGSIIKSLFNSKANNEPNEFLVKYD
KYFNSENGSIFKLHTQLKEFPMLGILGGLQSLPNMIADQLIKNSPNVHIQRNEEIVSLNE
NKKTNRITLQSNKDKNTYEFDHVMITSNPMKIKNLFEGEDDIKKELEKAKSVSTILINYY
LPNKDVIPKNLQGFGYLVPQINENKEKLLGVIFDSVIEKNFKPFEEGENILVNDYTKLTL
MLGGHYIENLSENKINDSKYWINTSKSLLTRHLNVSKTDLENGHWEFTVAKNGLPRFFVN
YTEWSNNLKSLISSKYGDKVTMGGMGFAKGPGVPDVIMKSLHDSIALSGVENKE
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgatcaattctattgccaaggtcaaatgcaatggttcagtgggtgttattgggagtggt
gtttcaggtttaacttttgcttattttctaaataaattaagaccagatttaagaataact
atattggataaccaacataagaacggtggttggttatattcctatacttttaaggatgaa
aatgataatggtaaagaagttatggtagagaagggtccaagaactttgagaggtgcttct
cccggcacagctattattattgatacttttgaaaaaatgggtcaaatagaaaaagttcaa
actatcgaatcgaattgcactgccaataggaaatttttattatcaactaatgacaaactc
gtacaagtaccaaataaactttttagtatgaacacttttaatttacttttcaaagatcct
ttgggtaaaaacgtactgtcaagtgtcttattcgaaccctttagaaaaagtaaacctttg
acaaaggatgaaactgttcatgaatttttatcaagaagatttggcccatctaacgctata
agtaacaattttttaagtgccatttatcatggtatttatgccgatgatattaaaaaaatc
tcattagagaaaactaatccagcattttataaccttgaaaagcagcatggttccattata
aaatctctcttcaattcaaaggctaataatgaaccaaatgaatttttggttaaatacgat
aaatacttcaatagtgaaaatggttcaatttttaaattacatacacaattgaaagaattt
ccaatgttggggattttaggaggtttacaaagtttaccaaatatgatcgctgaccaatta
attaaaaatagtccaaatgtgcatattcaacgtaatgaagagatagtttcattaaatgag
aataaaaagacaaatagaataacgttacaaagtaataaagataaaaacacttacgaattt
gatcatgtcatgattacaagtaatccaatgaaaatcaagaatttatttgaaggtgaggat
gatattaagaaggaattagaaaaagctaaatctgtaagtaccattttgatcaattattat
ttaccaaataaagatgttataccaaagaacttgcaggggtttggttatctagtaccacag
attaatgaaaataaagaaaaactgttaggtgtcatctttgattctgtaattgaaaaaaat
ttcaaaccttttgaagaaggtgaaaatatccttgtcaatgattatactaaattaacatta
atgttaggaggtcattatatcgaaaacttaagtgaaaataaaatcaatgactccaaatat
tggatcaacacttccaaaagtctcttgacaagacacttgaatgtttcaaaaactgattta
gaaaatggtcattgggaattcacggttgccaaaaacggtttaccaagattctttgtaaat
tataccgaatggtccaacaatttgaaatcattaattagcagcaagtatggagataaagtt
acgatggggggtatgggcttcgccaagggacctggtgtcccagacgttataatgaaaagt
ttacatgattcaatcgctttaagtggcgttgaaaataaagaataa

DBGET integrated database retrieval system