KEGG   Vanderwaltozyma polyspora: Kpol_1064p52Help
Entry
Kpol_1064p52      CDS       T01049                                 

Definition
hypothetical protein
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
vpo  Vanderwaltozyma polyspora
Pathway
Protein processing in endoplasmic reticulum
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:vpo04141]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 325 aa AA seqDB search
MLLLLSLQKVLLLWLAGNLIGYVSGSQPSFYTTDTHIMELDSSNFDSVVHNTNYTTLVEF
YAPWCGYCQQLKGIMHKVGKKLDGLVQVAAVNCDLGKNKQICGSYKIEGFPTLLVFKPPK
IDLTKNPKDRLNFDYHANEMYRGERKLAPIIDFCLSRVKNYVKKISSIKSLQSYLQNGTS
PIHGVLFSKKNLVSPTQKSIALDWLGKINFSTIPNDKLKESVIDSKLSKTNPNIAAYLQE
LIPTQKNNNKSMFVLFDIENDKYYVHEGEDMSKIGISQFIIDTINVKPSEGPLSKRFKYL
ESVKTNKKRSKKNKKAGKRKNHDEL
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgttgctgttgttgtcgttgcaaaaggttctacttttatggctagctggtaatttgatt
ggatatgttagtggtagccagccaagtttttacactaccgatacacatataatggagcta
gactccagtaacttcgattcagtagttcacaacaccaattatactactctagttgaattc
tatgccccatggtgtggttactgtcaacagttgaaagggataatgcacaaagtgggtaag
aaattggatgggttggtacaagtagctgctgtaaattgtgatttaggcaagaacaagcag
atatgtggtagttataaaatagaagggttcccaacattgctagttttcaagccacctaag
attgatctaacaaagaacccaaaagacagattaaattttgattatcatgccaatgagatg
tatagaggagaaaggaaattggccccaattattgatttctgtctatcaagagtgaagaat
tatgtcaagaaaatatcttcgataaagagtttgcaatcctatttgcaaaatggaaccagc
ccaattcatggtgtgttattttccaaaaagaatcttgtatcaccaactcaaaagagcatt
gcattagattggctaggaaagataaacttttcgacaatcccaaatgataaactaaaagag
agtgttatcgattcaaaactctccaaaacaaacccaaatattgctgcataccttcaagaa
ttgatcccaacccaaaagaataataacaagagcatgtttgttctttttgacatcgagaat
gataaatactatgtccatgaaggtgaggatatgtcaaaaataggaataagtcaattcatt
atagatacaattaacgtcaaacctagtgaaggacctttaagtaagagatttaaatatctt
gaatcagtgaaaactaacaagaagagatccaaaaaaaacaagaaagctgggaaacgtaag
aatcatgatgaattgtaa

DBGET integrated database retrieval system