KEGG   Vanderwaltozyma polyspora: Kpol_1067p15Help
Entry
Kpol_1067p15      CDS       T01049                                 

Definition
hypothetical protein
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
vpo  Vanderwaltozyma polyspora
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:vpo00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 242 aa AA seqDB search
MSKDNDLSIPRTETPLKTKPSQPYTLIAPVEADGFSWPSLGSRVRADEDEEQEKQRVGRI
ADAVKVILEELGEDVTREGLLDTPQRYAKAMLYFTKGYQTNIMDDVIKNALFEEDHDEMV
IVRDIEIFSLCEHHLVPFFGKVHIGYIPNKKVLGLSKLARLAEMYARRLQVQERLTKQIA
MALRDILKPIGVAVVIEATHMCMVSRGIQKTGSSTVTSCVLGAFRAHKTREEFLSLLSKR
SI
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaagataatgatttgtctattcctaggactgagactcctttgaagactaaacct
tcccagccatatacgttgattgctccagtggaggcagatggattttcttggccaagtctt
gggtcgagggtacgtgctgatgaggatgaagaacaagagaaacagagggttggacgtata
gcagatgcagttaaggtgatcttggaggaattaggtgaagatgtcactagagagggcctt
ttagatactcctcagaggtatgctaaagccatgctttatttcaccaagggctatcaaacg
aatattatggatgatgttattaagaatgcattgttcgaagaggatcatgatgaaatggtt
atagttagagatatcgagattttttctttatgtgagcaccatttggttccattctttggt
aaagtgcatattggttatattcctaataagaaagttttgggtttgagtaagcttgccaga
ttagcagagatgtatgctagaagattgcaagtccaagagagattgactaaacagattgca
atggctctaagagacattctgaaaccaatcggtgtcgctgtggtgatagaggctacccat
atgtgcatggtttctagaggtatccaaaagaccggttcctctactgtcacctcctgtgtg
ttgggtgcctttagagctcataagacaagggaagaattcttgagtttgttatcaaagaga
agcatttga

DBGET integrated database retrieval system