KEGG   Vanderwaltozyma polyspora: Kpol_1069p14Help
Entry
Kpol_1069p14      CDS       T01049                                 

Definition
hypothetical protein
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
vpo  Vanderwaltozyma polyspora
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:vpo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Kpol_1069p14
Enzymes [BR:vpo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     Kpol_1069p14
Glycosyltransferases [BR:vpo01003]
 Polysaccharide
  Storage polysaccharide
   Kpol_1069p14
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 709 aa AA seqDB search
MGRDLKKQLLFETATEVANRVGGIYSVLKSKVPVTVAEFGDNYTLLGPLNKATYQTEVDQ
FDWMDDNNYPDDLRFIKSVLMRMSERGVHFVYGRWLVEGSPRVLLFDLGSVSHFLNEWKK
DLWDLVGIPTPENDSETNDAVLLGYTVTWFLGELAFIDQEHVIIAHFHEWLAGVGLPLCR
KRRIDLVTIFTTHATLLGRYLCAAGNVDFYNNLDRFDVDLEAGKRGIYHRYCIERAAVHT
ADVFTTVSHITALEAEYLLKRKPDGILPNGLNVKKFQAVHEFQNLHAMRKEKINDFVRGH
FHGCFDFELDDTIYFFIAGRYEYKNKGADMFIEALARLNYRLKVSGSKKTVVAFIIMPAK
NKSFTVEALKSQAVVQSLESTVNEVTKLIGQRIFDHAIRYPSKGFASELPTNLDDLLKPS
DKVLLKRRTLNLRRREGELPPIVTHNMIDDATDPILNQIRSVQLFNNSSDRVKIIFHPEF
LNANNPILSLDYEDFVRGCHLGVFPSYYEPWGYTPAECTVMGVPSITTNVSGFGAYMEDL
IETDQAKDYGIYIVDRRFKSPEESVEQLVDMMEEFVKKNRRQRINQRNRTERLSDLLDWK
RMGLEYMKARHLALRRGYPDEYKELTGVEGDDTDMNTLVMDKKVKLSRPLSVPGSPRDSY
GRANSISAVYMTPGDLGTLQEINTADDYFLLAKGEEEEEDDEDDENVDE
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgtgatttgaagaagcagttattattcgaaactgctaccgaagtagccaacaga
gttggtggtatttactcagttttaaaatcaaaagttcctgtaactgtagctgaattcggt
gacaattatactttacttggtccattgaataaagctacttaccaaaccgaagtcgaccaa
ttcgactggatggatgacaacaactatcctgatgatttgagatttattaagtctgtatta
atgagaatgagtgaacgtggcgtacatttcgtttacggtcgttggttggtcgaaggctct
cctcgtgtgctattgttcgacttaggctctgtatctcattttttgaatgaatggaagaaa
gacctttgggatttagtgggtattccaaccccagaaaacgacagcgaaactaatgatgca
gttttgttaggttacaccgtcacttggttcttaggtgaattggcatttattgatcaagaa
catgtaatcattgcacatttccatgaatggttggccggtgtaggtttaccactttgtaga
aagagaagaatcgatttagtcaccatctttactactcatgcgactctattaggtagatat
ttatgtgcagctggtaatgttgatttctataataatttggatagatttgatgttgatcta
gaagctggtaagcgtggtatttaccaccgttattgtatcgaacgtgctgctgtccacacc
gctgacgttttcaccactgtctctcatatcactgctttagaggctgaatacttattgaag
agaaaacctgacggtatcttaccaaatggtttgaacgttaagaaattccaagctgttcat
gaattccaaaatttacatgctatgagaaaggaaaaaatcaatgattttgtcagaggccat
ttccatggttgcttcgatttcgaattagatgacactatttatttctttattgctggtaga
tatgaatataaaaataagggtgctgatatgtttattgaggcattggcaagactaaattat
agattgaaagtgtcaggttccaagaaaactgttgttgccttcatcattatgccagcaaaa
aataagtctttcactgtggaagctttgaaaagtcaagcagttgtccaatcattagaaagt
actgttaacgaagttacgaaattaattggtcaaagaatttttgaccatgctataagatat
ccttccaagggctttgcatcagaattgcctaccaatttagacgatttattaaaaccatct
gataaagttttattgaagagacgtacattgaatttgagaagacgagaaggtgaattgcca
ccaatcgttacccataacatgatcgatgatgccactgatccaattttgaatcaaattaga
agcgtccaattgttcaacaattcatctgacagagttaaaattattttccaccctgagttt
ttgaatgcaaacaatccaattttaagtttagattatgaagatttcgttcgtggttgtcat
ttaggtgttttcccatcatactatgaaccttggggttacactcctgccgaatgtactgtc
atgggtgttccatcaattaccaccaacgtttcaggttttggtgcatacatggaagattta
attgaaactgaccaagctaaggactatggtatttacatcgttgaccgtcgtttcaagagt
cctgaagaatctgttgaacaattagttgatatgatggaagagtttgttaagaagaataga
agacaaagaatcaaccaaagaaatagaactgagagattatctgacctattggattggaag
agaatgggtcttgaatacatgaaagcacgtcatttagcattacgcagaggttacccagat
gagtataaagaactaacaggtgttgaaggtgacgacactgacatgaacacattggttatg
gataaaaaagttaaattatccagaccattaagtgttccaggatccccaagagactcctac
ggtagagcaaacagcatcagtgcagtttatatgaccccaggtgatctaggtaccttacaa
gaaatcaatactgccgatgattacttcttactagctaaaggcgaagaagaagaagaagat
gacgaagatgatgaaaacgttgacgaatag

DBGET integrated database retrieval system