KEGG   Vanderwaltozyma polyspora: Kpol_1070p2Help
Entry
Kpol_1070p2       CDS       T01049                                 

Definition
hypothetical protein
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
vpo  Vanderwaltozyma polyspora
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:vpo00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Kpol_1070p2
Enzymes [BR:vpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Kpol_1070p2
Exosome [BR:vpo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Kpol_1070p2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 662 aa AA seqDB search
MVVTASPLFDSSSENIVPLVASIDVGTTSSRAILFNRLGQEVAKHQIEYSTTASKDKKKN
QSQQKRPSVVGSVDMKKSVTEDQIFSAEGIAIKENEYLKIEELTDDVAEPTLRFPQPGWV
ECNPMNILTYVVECLATTFNTLDNLNKERSENNLPLYKITCMGVANMRETTLVWSKKTGM
PIVDYGIVWNDTRNSKLVTDKKNATPEDVQQRLKDKTGLPIFSTYFSCSKLRWFLDNEPT
VMDAYEAGDLMFGTIDTWILYSVTHNNAFVSDVTNASRTGFMNLDTIDYDEELITFWNID
PKKIHLPKIVSSAEYYGDFNINDCLYERLSENGKTYIERHRKCHPSIPLQGCLGDQSASL
VGQMAFKPGSAKCTYGTGCFLLFNTGTKKLISKHGALTTFGYWFPYLNGEEQSQPHFALE
GSIAVAGAVVQWLRDNLRMFPRAEDVGPMASQVKDSGGVVFVPAFSGLFAPYWDQDARAT
IMGMSQYTTASHIARAAVEGVCFQARAILKAMSSDAFGGDGDKDFLEEVSEEAYEQSPLS
TLAVDGGMSRSDEVMQIQADILGPCIKIRRSPTHECTALGAAIAANMAFKDEKDRLLWKD
LKDVKKWVYYGGHEKGDQIGADELNLKVFESESSDEERRSHWKLWEAAIERTKGWLSATE
GL
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atggttgtcactgcttcacctttgttcgactcatcttctgaaaacatcgttcctttagta
gcttctatcgatgtcggtactacctcttctcgtgccatcctgttcaacagattaggtcaa
gaagttgctaagcatcaaatcgaatactctactactgcatcaaaggacaaaaagaaaaac
caaagccaacaaaagagaccaagtgtcgttggtagtgtggacatgaagaagtctgtcact
gaagatcaaattttctcagctgaaggtattgccattaaagaaaatgaatatttgaagatt
gaagaattaactgacgatgtagccgaaccaactttaagattcccacaacctggttgggtc
gaatgtaacccaatgaacattttgacttatgtcgtcgaatgtttggctaccacttttaac
actttggacaacttaaacaaagaacgttcagaaaataatttaccattatacaaaatcacc
tgtatgggtgtagcaaatatgagagaaaccactttggtttggtcaaagaaaactggtatg
ccaattgtagattacggtattgtttggaatgatactcgtaactctaagttggttacagac
aagaaaaacgctaccccagaagatgtccaacaaagattaaaggataagactggtttgcca
attttctctacttatttttcatgttctaaactaagatggttcttggataacgaaccaact
gtcatggatgcttatgaagctggtgatttgatgtttggtactattgatacctggattcta
tatagtgtcactcacaacaacgccttcgtttcagatgtcactaatgccagtcgtaccggt
ttcatgaatttggacactattgattatgatgaagaattaatcactttttggaatattgat
ccaaagaagattcatttaccaaagattgtttcatctgctgaatactatggtgatttcaat
attaatgactgtttgtatgaaagattatctgaaaatggtaaaacttacattgaaagacac
agaaaatgtcacccaagtattccattacaaggttgtctaggtgatcaaagtgcatctttg
gttggtcaaatggcattcaaaccaggttctgctaagtgtacttacggtactggttgtttc
ttactattcaacacaggtactaagaagttgatctcaaaacatggtgctttgaccacattc
ggttattggttcccatacttgaatggtgaagaacaatctcaaccacattttgctttagaa
ggttctattgctgtcgctggtgccgttgtccaatggttgagagataacttaagaatgttc
ccaagagctgaagatgttggtccaatggcctcccaagtcaaagattctggtggtgttgtc
tttgtcccagctttctctggtttattcgctccatactgggatcaagatgctcgtgctact
attatgggtatgtctcaatataccactgcttctcatattgccagagctgctgtcgaaggt
gtttgtttccaagctagagctattttgaaggctatgagttctgatgcttttggtggtgat
ggtgacaaagatttcttggaagaagtctctgaagaagcatatgaacagtctccattgtcc
actttggctgttgatggtggtatgtctagatctgatgaagttatgcaaattcaagctgat
attctaggtccatgtattaagatcagaagatccccaactcacgaatgtactgccttgggt
gctgctattgctgccaacatggccttcaaggacgaaaaggaccgtttgttgtggaaagat
ctaaaagatgttaagaagtgggtctactacggtggtcatgaaaaaggtgatcaaattggt
gctgatgaattgaacttgaaggtcttcgaaagtgaatctagtgatgaagaaagaagatct
cactggaaactatgggaagctgccattgaaagaaccaagggttggttatctgctacagaa
ggtttgtaa

DBGET integrated database retrieval system