KEGG   Vanderwaltozyma polyspora: Kpol_1071p12Help
Entry
Kpol_1071p12      CDS       T01049                                 

Definition
(RefSeq) hypothetical protein
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
vpo  Vanderwaltozyma polyspora
Pathway
vpo00010  Glycolysis / Gluconeogenesis
vpo00051  Fructose and mannose metabolism
vpo00562  Inositol phosphate metabolism
vpo01100  Metabolic pathways
vpo01110  Biosynthesis of secondary metabolites
vpo01130  Biosynthesis of antibiotics
vpo01200  Carbon metabolism
vpo01230  Biosynthesis of amino acids
Module
vpo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
vpo_M00002  Glycolysis, core module involving three-carbon compounds
vpo_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:vpo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Kpol_1071p12
   00051 Fructose and mannose metabolism
    Kpol_1071p12
   00562 Inositol phosphate metabolism
    Kpol_1071p12
Enzymes [BR:vpo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Kpol_1071p12
Exosome [BR:vpo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Kpol_1071p12
  Exosomal proteins of bladder cancer cells
   Kpol_1071p12
  Exosomal proteins of melanoma cells
   Kpol_1071p12
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 5543157
NCBI-ProteinID: XP_001642963
UniProt: A7TRK7
AA seq 248 aa AA seqDB search
MARTFFVGGNFKLNGDKKSIKEIVERLNTANLAENVEVVICPPAAYIDYTVQLVNKPQVT
VGGQNTYLKASGAFTGENSVDQIKDLGAKWVILGHSERRTYFHEDDKIVADKTKFALDNG
VGVILCIGETLEEKKAGITLEVVERQLNAVIAEVKDWTNVVIAYEPVWAIGTGLAATAED
AQDIHASIRKFLVSKIGEKAAEEIRILYGGSANGGNCSTFKDKKDIDGFLVGGASLKPEF
VDIVNSRM
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggctagaactttcttcgtcggtggtaacttcaaattgaacggtgacaaaaaatctatc
aaggaaatcgttgaaagattgaacaccgctaacttggctgaaaacgttgaagtcgttatc
tgtccaccagctgcttacatcgactacactgtccaattggttaacaagccacaagtcact
gtcggtggtcaaaacacttacttgaaggcttctggtgctttcactggtgaaaactctgtt
gaccaaatcaaggacttaggtgctaaatgggtcatcttaggtcactctgaaagaagaact
tacttccacgaagatgacaagattgttgctgacaagactaagtttgctttagacaacggt
gttggtgtcatcttgtgtattggtgaaactttggaagaaaagaaggccggtatcactttg
gaagttgttgaaagacaattgaacgctgtcattgctgaagttaaggactggactaacgtt
gttattgcttacgaaccagtctgggctattggtactggtttagctgccactgctgaagat
gctcaagacatccacgcttccatcagaaagttcttggtttccaagatcggtgaaaaggct
gctgaagaaatcagaatcttatacggtggttccgctaacggtggtaactgttctactttc
aaggacaagaaggacattgacggtttcttagtcggtggtgcttctttgaagccagaattt
gttgacattgttaactctagaatgtaa

DBGET integrated database retrieval system