KEGG   Vanderwaltozyma polyspora: Kpol_1071p14Help
Entry
Kpol_1071p14      CDS       T01049                                 

Definition
hypothetical protein
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
vpo  Vanderwaltozyma polyspora
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:vpo00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Kpol_1071p14
Enzymes [BR:vpo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     Kpol_1071p14
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 483 aa AA seqDB search
MQLPKYVNKPFKPPRSIGSSSSSSTPSPKPSVLKRSVPSIDSVSSLKKPKSNDCVSEPCK
HAPSSAKFNDDIKHVFTAMYRKSTMKKHKTWTGDGYALYKITNKVLFYDDGGKYLASTTY
SEDIDSIYGNIFKYGSLEFQIDYEIKDKDEISKTYSAINNSRGKAVENSKSKPVKRDETP
MKDNYMPLSQLFTAKIKPKSKFQNPALKTEIKHQTNSLDSNSKAGTVERKYLPVFDVTKI
ESPIIMNKASDAEVDVIIDPLLGKFLREHQKQGVKFMYDCIIGFCRPEEKKDTDCSNSLI
LEKDYDINGCLLADEMGLGKTLMTITLIWTLLKQTAYPSKVLRNQSGMALHGAYRKFIVV
CPVTLIDNWKKEFAKWLTLARIGILTLKSKNNSEKDKFEVKGFLRVQRTYQVLIIGYEKL
LSVSEELLSGKDNIDMLICDEGHRLKNGSSKILNILKSLDVKSKILLSGTPIQNDLNEFF
TII
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atgcaacttccaaaatatgtgaataaaccatttaagccaccaaggagtattggtagtagt
tcatcaagttcaacaccgtctccaaagccatcggtacttaaaagatctgtaccttctata
gattcggtttcctctttaaagaagcctaaatcaaatgattgcgtttcagaaccatgcaaa
catgcaccatccagtgcaaaatttaatgatgatataaagcatgtgtttaccgccatgtac
aggaaatccactatgaagaagcataagacatggactggggacggatatgccctttataag
atcacaaataaggtattgttttatgatgatggtggaaaatatttggctagcaccacttat
tctgaggatattgactctatatatggtaacatttttaaatatggttctttggaatttcag
atcgattatgaaataaaggataaagatgaaatatcgaaaacgtattctgcaattaataac
agccgtggtaaggctgttgagaatagcaaatcaaaaccagtgaaaagagatgaaacgcca
atgaaagacaattatatgccattatctcaactttttaccgctaagattaaaccaaagtca
aaattccaaaacccagccttaaaaacagaaattaagcatcagactaatagtttagatagt
aattctaaagctggtacagtggagaggaaatatctacctgtatttgacgttacaaagatt
gaatcgcctataattatgaataaagcgtcggatgctgaagtagacgtaataattgatcca
ttattaggtaaatttttacgtgagcatcaaaaacaaggtgtgaagttcatgtacgattgt
ataattggtttttgtagaccagaagaaaaaaaagatacggattgttccaattcattgatt
ctggaaaaagattatgacattaacggatgtctactagctgatgaaatggggttaggtaaa
acgttaatgacaataacattaatctggacactattaaaacaaacagcctatccgtctaaa
gttttaagaaaccagtcaggtatggcattgcatggtgcttatagaaaattcattgttgtt
tgcccagtgactttgatcgataattggaaaaaggaatttgcaaaatggctgacattggct
agaattgggattttaactttgaaatcaaagaataactccgaaaaagataagtttgaagtt
aaaggttttctaagagtacaacgaacttaccaagttcttataatcgggtatgaaaagtta
ctttctgtatcggaagagcttctatcaggaaaagataatatagatatgttaatttgtgat
gaaggacatcgtttaaagaatggatcatcaaagattttaaacatattaaagagcttggac
gtgaaatcaaaaatattactgtctggaactcctatacaaaacgatttgaatgaattcttt
acaataatc

DBGET integrated database retrieval system