KEGG   Vanderwaltozyma polyspora: Kpol_1072p26Help
Entry
Kpol_1072p26      CDS       T01049                                 

Definition
hypothetical protein
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
vpo  Vanderwaltozyma polyspora
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:vpo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Kpol_1072p26
   00670 One carbon pool by folate
    Kpol_1072p26
Enzymes [BR:vpo01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Kpol_1072p26
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 221 aa AA seqDB search
MSQLPVVSIVACLLPEFGIGLQGTLPWRLAKEMKFFRQVTSSTFDSGKQNAVIMGRKTWE
SIPAKFRPLPNRTNVVISRSFTADLVLSDDNSYLKCNSLYDSIEKLNSSYKDKIERVYII
GGGEIYKESLNLCDYWLITKIVPLETGSDDDVPPPKVDTFLDSKTLSENYIEDKNVDLGT
FLPSQVELPDKESPCKNSSVPLKYAQQERGLEFGYSLWRKK
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgtctcagttaccagtagttagtattgttgcatgcttacttcctgagtttggaatcggt
cttcaaggtactctaccttggaggttggccaaagaaatgaaattcttcagacaggttact
tcaagtacttttgattcaggtaaacaaaatgcagttattatgggtagaaagacatgggaa
tctattcctgccaaattcagaccattgccaaacagaaccaacgttgttatttcaagaagc
tttactgcagatctggttctttctgatgataattcttatctaaaatgtaactcattatat
gattcaattgaaaaattgaattcttcctataaggacaagatcgaacgtgtgtatataatc
ggtggtggtgaaatatataaagaaagcctgaacttatgtgattactggttaattacaaaa
attgtacccttagagacaggatctgatgatgatgtcccaccaccaaaagttgatactttt
ttggatagcaaaacactgtctgaaaattatatagaagataaaaatgttgatttaggaaca
tttttaccttctcaagtcgaattacctgacaaagagagtccatgtaaaaattccagcgta
cctttaaaatatgcccaacaagagagaggattagagtttggatattctctctggaggaaa
aaatga

DBGET integrated database retrieval system