KEGG   Vanderwaltozyma polyspora: Kpol_1072p31Help
Entry
Kpol_1072p31      CDS       T01049                                 

Definition
hypothetical protein
Orthology
K08294  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
vpo  Vanderwaltozyma polyspora
Pathway
MAPK signaling pathway - yeast
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - yeast [PATH:vpo04011]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 526 aa AA seqDB search
MSSIFRPPESAKPNAKSPKLTLPGLGKNSNTVPSNDRNVYLSSAPSSKSEGPSSSLGSSV
SRPVTPQPPSSDSTIVPNYYKSQQINSATSSGSSSSLTKKSRPAPPPLPPLVVAKGNNSQ
QPGSKGSYTNLSASLQKLKINTDTTNDSLNSASSGKKTPIRIDGDTSGNMIYLSKDLNAS
TDSYPSALISSYDQNSSANTSPSKSPYRNGTNSTPGNDIDEIGEELWNHTHFKDEIVTLG
LLGEGAGGSVAKCKLKSGSKIFALKTINTLNTDPEYQKQIFRELQFNKSFKSDYIVRYYG
MFTDESNSSIFIAMEYMGGRSLDAIYLNLLNLGGRIGEKVLGKIAESVLRGLSYLHERKV
IHRDIKPQNILLNEKGQVKLCDFGVSGEAVNSLATTFTGTSFYMAPERIQGQPYSVTCDV
WSLGLTLLEVAQAKFPFGSDKMTATIAPIELLMLILTFSPQLKDEPELNIVWSKSFKSFI
EYCLKKDPSERPSPRQMIQHPWIQGQMKKKVNMEKFVRKCWENDRT
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgtcaagcattttcagacctccagagtctgctaaaccaaatgccaaatctcctaagtta
acattaccaggtttaggtaaaaatagtaataccgtcccttcaaacgacagaaatgtatat
ctttcttcagcaccatcttcaaaaagtgaaggtccatcaagtagtttaggttcctcggta
tcgagaccagtaactccacagcctccttcatctgattcaacaattgtgcccaattattat
aaatcacagcagataaactctgcaacttcatctggatcatcttcttcgttgaccaaaaaa
agtaggcccgcacctcctccactaccacctttagtagtagctaaaggtaataactcgcaa
caaccaggttcaaaaggttcatataccaatctatcagcttctctccagaaattaaaaatc
aacacagatacaactaatgatagtttgaacagtgcttcctcagggaaaaagactccaata
cggatagatggcgataccagtggcaatatgatttatttaagtaaggatctgaatgcttcc
acagattcgtacccttcagctttaattagttcatatgatcaaaatagtagcgccaatact
agcccatcgaaatcaccatatcgcaatgggaccaattcaacccctggtaatgatattgat
gagattggagaagaattatggaaccatacacatttcaaagatgaaatagttactttagga
ttacttggtgaaggtgccggtggttcagttgccaaatgtaagctaaaaagtggctccaaa
atatttgcattaaaaactattaatactttaaatactgatcctgaataccaaaagcaaatt
tttagagaattacaattcaataaaagtttcaaatcggattatatcgtaaggtactatggt
atgtttaccgatgagagtaattcttcaatttttatcgcaatggaatatatgggtgggaga
tcattagatgcaatttatctgaacttactaaatcttggtgggagaattggtgagaaagtt
ttagggaagatagcagaatccgttttacgaggcttatcgtacttgcatgagaggaaagtt
atacatagagatatcaagccgcagaatatattattaaatgagaaaggtcaagttaaatta
tgtgatttcggtgttagtggagaagcagttaactcgttagcgacaacatttacaggtact
tcattctatatggctcctgagagaatccaaggccagccatatagtgttacatgtgatgtt
tggtcgttaggtctaacattattagaggttgcgcaagctaaatttccatttggttcagat
aagatgactgcaactattgcacctatcgaactactgatgttaattttgactttttcacca
caactaaaagatgaaccagagctaaacatagtctggagtaaatcattcaagtcatttatt
gaatattgtttaaagaaagaccccagcgaaaggccatcaccaagacaaatgatacagcat
ccttggatacaaggtcaaatgaagaagaaagtaaacatggaaaagtttgttaggaaatgt
tgggaaaatgaccgtacttaa

DBGET integrated database retrieval system