KEGG   Vanderwaltozyma polyspora: Kpol_167p3Help
Entry
Kpol_167p3        CDS       T01049                                 

Definition
(RefSeq) hypothetical protein
  KO
K10739  replication factor A2
Organism
vpo  Vanderwaltozyma polyspora
Pathway
vpo03030  DNA replication
vpo03420  Nucleotide excision repair
vpo03430  Mismatch repair
vpo03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:vpo00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Kpol_167p3
   03420 Nucleotide excision repair
    Kpol_167p3
   03430 Mismatch repair
    Kpol_167p3
   03440 Homologous recombination
    Kpol_167p3
DNA replication proteins [BR:vpo03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   RPA (replication protein A)
    Kpol_167p3
DNA repair and recombination proteins [BR:vpo03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    RPA (replication factor A)
     Kpol_167p3
   MMR (mismatch exicision repair)
     Kpol_167p3
  DSBR (double strand breaks repair)
   HR (homologous recombination)
     Kpol_167p3
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA_anti-codon RPA_C HTH_IclR CDC24_OB3 HTH_24
Motif
Other DBs
NCBI-GeneID: 5542304
NCBI-ProteinID: XP_001642188
UniProt: A7TTS8
AA seq 274 aa AA seqDB search
MATYQPYSEYSTGGGFENSDSRGGSAEGSGNSLRISTLTPVTVKQILESKQLIQDGPFIS
YNQELHSISFVGVVRNITDHTSNIFLTIEDGTGQIEVRKWSEDASDIATSQENADSGSSD
SQIAKQYKIGTYVKVYGALKEFGGKKNVQYAVIKNVTSFNEIIAHHLEVIKCHAIANGKL
QDASRVDEQASNNNDQSLFVKESETGSSTNPLDRILAFCKEQCSGKDANTFAVPIPLISQ
SLNIDENTVRECCNTLTEQGFIYPTFDDNNFFAL
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atggccacttatcaaccatatagcgaatactccactgggggtggatttgaaaactctgat
tctagaggtggatctgcagaaggtagtggtaattcccttcgtataagtacattgactcca
gttacagttaaacagattttggaatcaaaacagttgattcaagatggaccttttatatca
tataatcaagaattacactctatttcatttgtgggtgtagtaagaaacattactgatcat
acctctaatatatttctaacaatcgaagatggtactggtcaaatagaagtaaggaaatgg
agtgaagatgcttccgatatagctacttcacaagaaaacgctgacagcggtagcagcgat
tctcaaatagcgaaacagtataagattggtacttatgtgaaagtatatggtgctctgaaa
gaatttggtggtaagaaaaatgttcaatatgcagttatcaaaaatgtcacctcattcaat
gagatcattgcacaccacttggaggtcattaaatgtcatgctattgctaatggaaaacta
caggatgcatcaagggttgacgaacaagcatctaataacaacgatcaatcactatttgta
aaagaatctgaaacaggtagttcaaccaatccattagatagaattttagccttctgtaaa
gaacaatgtagcggaaaagacgccaacacctttgccgtcccaattccattgatttcacaa
tctttaaatatcgatgaaaatacagtaagagagtgttgcaacacattaactgaacaaggt
ttcatttatccaacttttgatgacaataacttcttcgctttgtaa

DBGET integrated database retrieval system