KEGG   Vanderwaltozyma polyspora: Kpol_167p3Help
Entry
Kpol_167p3        CDS       T01049                                 

Definition
hypothetical protein
Orthology
K10739  
replication factor A2
Organism
vpo  Vanderwaltozyma polyspora
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Brite
KEGG Orthology (KO) [BR:vpo00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Kpol_167p3
   03420 Nucleotide excision repair
    Kpol_167p3
   03430 Mismatch repair
    Kpol_167p3
   03440 Homologous recombination
    Kpol_167p3
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 274 aa AA seqDB search
MATYQPYSEYSTGGGFENSDSRGGSAEGSGNSLRISTLTPVTVKQILESKQLIQDGPFIS
YNQELHSISFVGVVRNITDHTSNIFLTIEDGTGQIEVRKWSEDASDIATSQENADSGSSD
SQIAKQYKIGTYVKVYGALKEFGGKKNVQYAVIKNVTSFNEIIAHHLEVIKCHAIANGKL
QDASRVDEQASNNNDQSLFVKESETGSSTNPLDRILAFCKEQCSGKDANTFAVPIPLISQ
SLNIDENTVRECCNTLTEQGFIYPTFDDNNFFAL
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atggccacttatcaaccatatagcgaatactccactgggggtggatttgaaaactctgat
tctagaggtggatctgcagaaggtagtggtaattcccttcgtataagtacattgactcca
gttacagttaaacagattttggaatcaaaacagttgattcaagatggaccttttatatca
tataatcaagaattacactctatttcatttgtgggtgtagtaagaaacattactgatcat
acctctaatatatttctaacaatcgaagatggtactggtcaaatagaagtaaggaaatgg
agtgaagatgcttccgatatagctacttcacaagaaaacgctgacagcggtagcagcgat
tctcaaatagcgaaacagtataagattggtacttatgtgaaagtatatggtgctctgaaa
gaatttggtggtaagaaaaatgttcaatatgcagttatcaaaaatgtcacctcattcaat
gagatcattgcacaccacttggaggtcattaaatgtcatgctattgctaatggaaaacta
caggatgcatcaagggttgacgaacaagcatctaataacaacgatcaatcactatttgta
aaagaatctgaaacaggtagttcaaccaatccattagatagaattttagccttctgtaaa
gaacaatgtagcggaaaagacgccaacacctttgccgtcccaattccattgatttcacaa
tctttaaatatcgatgaaaatacagtaagagagtgttgcaacacattaactgaacaaggt
ttcatttatccaacttttgatgacaataacttcttcgctttgtaa

DBGET integrated database retrieval system