KEGG   Vanderwaltozyma polyspora: Kpol_2000p104Help
Entry
Kpol_2000p104     CDS       T01049                                 

Definition
hypothetical protein
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
vpo  Vanderwaltozyma polyspora
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:vpo00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    Kpol_2000p104
Enzymes [BR:vpo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Kpol_2000p104
Exosome [BR:vpo04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   Kpol_2000p104
  Exosomal proteins of colorectal cancer cells
   Kpol_2000p104
  Exosomal proteins of bladder cancer cells
   Kpol_2000p104
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 541 aa AA seqDB search
MLLNKKTLFKLASLLSLATSALAQEDAIAPEDSDVVKLSGKDFESFIGKNNLVMAEFFAP
WCGHCKNLAPEYVKAAEKLKEHDIYLAQVDCTENQELCMEHQIRGYPTIKIFKNGNLEEP
KDYQGARKADAMIDFMIKQSLPTVMDVASEDELDSILLNATLPVVINNDVENFNETFHKM
ADKLFSDYVFVSYPLKKNPKLSVILSNEDDLDNEPIVYDGDLSKTSEEDFIKWLKVQSLP
FFGEINGETFNNYFESKLPLAYLFYNSQEELEKYSDFLTKLGEKHRGKLNFGALDAQKFG
RHADNLNMKEQFPLFVIHDMDSNYKYGLKQLADEEFEKLTAPIVLKEKEIKKLVEDVLAG
KAEPIVKSEPIPESQDSSVMKLVAHNHDEIIKDPKKDVLVKYYAPWCGHCKNLAPIYVDL
ADLLANDKSTKDKFVIAEIDATLNDVASVDIEGYPTIILYPSGMNAEPVTFQTKREIEDF
LNFLEKNGGNSLNAGKLAKQYQKELEEKKAEEEEKEKAAAAEKAANEAEDESNDDIEHDE
L
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgttgttgaataagaagactctatttaagttggcaagcttattgtctttggccacctct
gctttggctcaagaagacgctatcgccccagaagattcagatgtcgttaagctatctgga
aaggatttcgaatccttcatcggcaaaaacaacttggtcatggctgaattctttgctcca
tggtgtggtcattgtaaaaatttggctccagaatatgtcaaagctgctgaaaaattaaaa
gaacatgatatttacttggctcaagtcgattgtaccgaaaatcaagagttatgtatggaa
caccaaattagaggttatccaactataaaaatcttcaagaatggtaatttggaagaacca
aaagattaccaaggtgcaagaaaagctgacgctatgatagatttcatgattaagcaatct
ttgcctaccgtcatggacgttgcatccgaagatgaattggattccatcttattaaacgct
actttacctgtcgtcatcaacaatgacgtagaaaactttaatgaaactttccataaaatg
gctgataaattattctcagattatgttttcgtttcttatccattaaagaaaaatccaaaa
ttatccgtcattttatcaaatgaagatgatttggacaatgaaccaattgtatacgacggt
gatttatcaaaaacttcagaagaagatttcattaaatggttaaaagtacaatctttacct
ttcttcggtgaaattaacggtgaaactttcaacaactattttgaaagtaaattaccatta
gcttacttattctacaactcccaagaagaattagaaaagtactctgatttcttaactaaa
ttaggtgaaaaacatagaggtaaacttaacttcggtgctttagatgctcaaaaattcggt
agacatgctgacaacttaaacatgaaggaacaattcccattgtttgtcattcatgatatg
gactcaaactacaaatacggtttgaaacaattggctgatgaagaattcgaaaaattaacc
gctccaatcgtcttgaaagaaaaagaaattaaaaaattggtcgaagatgtccttgctggt
aaagctgaaccaattgttaaatctgaaccaatcccagaatctcaagactctagtgtcatg
aaattggtcgctcacaatcacgatgaaattatcaaggacccaaagaaggatgtcttagtt
aaatactacgctccatggtgtggtcactgtaagaatttggctccaatttatgtcgattta
gctgatttgttggctaacgataaatccactaaggataaattcgtaattgctgaaattgat
gctactttgaacgacgttgcttctgtcgatatcgaaggttacccaactatcattctatac
ccatcaggtatgaacgctgaaccagttaccttccaaaccaagagagaaattgaagatttc
ttaaacttcttggaaaagaacggtggtaactctttaaatgccggtaaattagctaaacaa
taccagaaagaattagaagagaagaaagctgaagaagaagaaaaggaaaaagctgctgct
gctgaaaaggctgccaatgaagctgaagatgaatccaatgatgatattgaacatgatgaa
ttgtaa

DBGET integrated database retrieval system