KEGG   Vanderwaltozyma polyspora: Kpol_2000p42Help
Entry
Kpol_2000p42      CDS       T01049                                 

Definition
hypothetical protein
Orthology
K13939  
dihydroneopterin aldolase / 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase / dihydropteroate synthase [EC:4.1.2.25 2.7.6.3 2.5.1.15]
Organism
vpo  Vanderwaltozyma polyspora
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:vpo00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 828 aa AA seqDB search
MTKDQNLKMLERRFMNMGISRFYSTSNNVAVVKNVKDKVYIEKLRVDAIVGPDCWGQLNP
QRCLITLGMSTDFGKASNTDDLSYSLNYAAISRDVTNFVNARKNWLSLSKLSRDVSDFAM
KSYKGIDMLELNVNSKDAHIRSEDVSCVVLKSRNEDSISEPKYDYLRITNLKLLTLIGIF
TFERLQKQFVTLDLIIPWPKDVKDTVSYKTIIDKVVAYTENANFKTVEALVESVAKVIAM
EPYFQQLQDVPIEVKVIKLNAITATEGVGVSCIRTPKELQSLHIETDQGKRNGVIEADNI
SSPFNLPVLERKISKINSAFLAFGSNVGDRFANINNALSLLQQNEKVNIEKVSSLFESEP
MYFKDQSPFMNGCIEITTQLTPHELLELCKKIEYDELKRIKHFDNGPRSIDLDIVMYIND
KGEHILINDETLVVPHPRMLERTFVLEPLCELISPTHIHPISAEPIFSSLQEIYKKQDPE
NELWVLNPLPGQSRFLKYKSVTKFNCFDNSYNRSLVSPTYLMAIINTTPDSFSGDGMLDN
DIDMQLKHIKELCDKALQLSDSIILDIGGCSTRPNSAQASNEEEFERTIPLIKAIRESNT
LPNSKIILSIDTYRASMAQKAIEAGVDIINDISGGSFDKDMFKVIAKNARVSYVLSHIRG
DISNMVTLNDYTEDKSENEEFIYGEKSTSSETSFIRTISRELAKSYEKAISEGIKRWQIL
LDPGLGFAKNGKQNLAIIKNLPIMKNYSVDLNDDTYVSFRNLPVLLGPSRKKFIGTITKD
DEPKDRDFATGALVASCIGNDTNIVRVHNAIECGKSVKIADTLYRDIE
NT seq 2487 nt NT seq  +upstreamnt  +downstreamnt
atgacgaaggatcaaaatttaaagatgttagaacgccgtttcatgaatatgggaatatct
cgattttattcaacttcaaataatgttgctgttgttaaaaatgtaaaggataaagtttac
attgaaaagttgagggtcgatgccattgttggtccagattgctggggtcaattgaatccg
caacgttgtttgatcacgttgggcatgtccactgattttggtaaagcttcaaatactgat
gatttaagttattctttgaactatgctgcaatatcaagagacgttacaaactttgttaac
gctagaaagaattggttatcactgagcaagctttctagggatgtatcagattttgccatg
aaaagttataaaggcatcgatatgttggaattgaatgtaaattctaaagatgctcatatc
agaagcgaagatgtttcctgtgtagtattgaaatcaagaaatgaagattccatctctgag
ccaaaatatgattatttgagaataactaatttgaagttgctgacactgattggcattttc
acttttgaaagattgcaaaaacaatttgtcacattggatttaatcattccttggccaaaa
gatgttaaagatactgtttcttacaagactatcatagataaagttgtggcgtatacagaa
aatgcaaacttcaaaacagttgaagcattggtggagtcagttgcaaaagttatagcaatg
gagccatatttccaacaattacaagatgtcccaattgaagtaaaagtaattaagctgaat
gctattaccgcaactgaaggagttggtgttagttgtataagaacaccaaaagaattacaa
tctttacatatcgaaactgatcaaggaaagcgcaatggtgtgatagaggctgataacatt
tcttcaccgtttaatttgcctgtattagagagaaaaatatcaaaaataaattctgcattt
ctggcttttggatccaatgtaggcgatagatttgcaaacataaacaatgcattgtccttg
ttacagcaaaatgaaaaagtcaacatcgaaaaagtgtcttctctattcgaaagtgaacca
atgtactttaaagaccaaagtccttttatgaatggttgtattgagatcaccacccaattg
actccacatgaactactcgaattatgtaagaagattgaatatgatgagttaaaaagaatc
aaacattttgataatggtcctagatcaattgatctcgatatcgtgatgtacatcaatgat
aaaggtgagcatattctgatcaatgatgaaacattggttgtaccacacccaagaatgctg
gaaaggacctttgtcttggaaccattatgtgaattgatttcaccaacccacattcatcca
atatcagcggaaccaattttttcatctttgcaagaaatctataagaaacaagatccagaa
aatgaattatgggtgttaaatcctttacctggtcaatcaagattcttgaagtataaatcc
gttacgaaatttaattgttttgataattcatacaatagatcactagtttctcctacttat
cttatggcaatcatcaacactactcctgattcgttttcaggtgatggtatgttggataat
gatattgatatgcaattaaagcatatcaaagaactttgtgataaggcattgcaactatct
gattcaattattttggatattggcggttgttcaactcgtccaaattctgctcaagctagt
aatgaagaagaatttgagcgtacaattcctttaatcaaagcgatcagggaatcaaatacc
cttccaaattcaaagattattctatccatcgacacttatagagcaagcatggcgcaaaaa
gctattgaagctggcgtagatattattaatgacatttcaggaggatcgtttgacaaagac
atgtttaaggtcattgcaaaaaatgcgagagtaagttacgttttatctcatattagaggt
gatatatcaaatatggttacattaaatgattatacggaggataaatctgaaaacgaagaa
tttatctatggtgaaaagagtacatcctctgaaacctcattcataagaacaatttccaga
gaacttgctaaatcctatgaaaaagcgatttcagaaggtattaaacgttggcaaatactt
cttgatcctgggttaggttttgctaagaacggtaagcaaaacttggcaattattaaaaat
ttgccaatcatgaagaattactcagtagatttgaatgatgacacttatgttagtttccgt
aatttaccagtactacttggtccttcaagaaagaaattcattggcaccattacaaaggat
gacgagccaaaggatagggattttgcaactggcgcattagttgcctcatgtatagggaat
gacacgaatatagttagggtacataacgcaattgaatgtggtaaaagtgttaagattgcg
gacactctttatcgtgacattgaatga

DBGET integrated database retrieval system