KEGG   Vanderwaltozyma polyspora: Kpol_2001p53Help
Entry
Kpol_2001p53      CDS       T01049                                 

Definition
hypothetical protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
vpo  Vanderwaltozyma polyspora
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:vpo00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Kpol_2001p53
Enzymes [BR:vpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Kpol_2001p53
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 334 aa AA seqDB search
MGITIIGSLNYDLVTYTNKIPNAGETIRANLFETHTGGKGLNQTVAIAKLKHPDSNYGIK
MVGNVGDDSFGKELVDILKQNNVNIDDIGILSDVKTGIATILVEQQNGGQNRILITEGAN
GKTDYSLEQLKSIFNNVSNNEEQFVVLQHEIPNPISIMSLLKNNFPTYKIVFNPSPFQPL
NKGDWLLIDVLIVNEIEALQIVNSVYSKDEIAKHESEINHDFVKGYTTLCEKFQKHLVNK
DGLSAVIITLGSKGVLYSSKDQPIVEYQPAKSGITVVDTTGAGDTFLGAVVTQLHQQSSL
KEAIDFATSASSITIQRNGAAESIPVYSEVVSRH
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atggggattacaatcattggttctttaaattatgatttggttacttataccaataaaata
ccaaatgcgggtgaaactataagggcaaatttattcgaaactcatactggtggtaaaggt
ttaaatcaaactgttgctatagctaaattgaaacatcctgattctaattatggtattaaa
atggttggcaatgtaggtgacgattcatttggaaaagaattagtagacattttgaaacaa
aataatgttaacatcgatgacattggtattctttctgatgttaagactggcattgctact
attctcgtagagcagcaaaatggtggacaaaatagaattttaattactgaaggtgcgaat
ggaaaaactgattactcattggaacaattaaagtcaatttttaacaatgtttccaataat
gaagagcaattcgttgttctgcaacatgagattccgaatccaatttcaattatgagctta
ttgaaaaacaatttcccaacttataagatcgttttcaacccttctcctttccaaccattg
aataaaggcgattggcttctaatcgatgtattaattgttaacgaaattgaagcattacaa
attgtaaattctgtttattcaaaggatgaaattgcaaaacatgaatcggaaataaaccac
gattttgttaagggttatactaccctatgtgaaaaatttcaaaagcatttagtcaacaaa
gatgggttatctgcagtaattattacattaggttcaaaaggtgttctatattcttcaaag
gatcagccaatagtagaatatcaacctgcaaaatctggtattaccgttgtagatactact
ggtgcaggtgatacattcttgggcgctgtcgtcactcaattacatcaacaaagttcattg
aaagaagcaatcgattttgcaacttcagcaagttctataactatccagagaaacggtgct
gccgaaagtatccctgtatattctgaagtagtttccagacattga

DBGET integrated database retrieval system