KEGG   Vanderwaltozyma polyspora: Kpol_2001p54Help
Entry
Kpol_2001p54      CDS       T01049                                 

Definition
hypothetical protein
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
vpo  Vanderwaltozyma polyspora
Brite
Enzymes [BR:vpo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     Kpol_2001p54
Peptidases [BR:vpo01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   Kpol_2001p54
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1223 aa AA seqDB search
MSIEMDNDSTSDHSLSSISRRSSYLNVSDGDDVTGDVVPVESMASTAECLMNSKLDENIE
VKPGLPEYPEITDEVIPSLPEQRHLVLQLAKEADVNAKEGDKVYIIPQRWYDNFMDPDIQ
DFNQIGSIDTNIICKDYDNFILNDYDVTPYLSIQESVFEKISSWYGLAPNSKPIVTCLIY
DDQSGSLVTEYNRCIFRLHYLTEDSKTNQYRHHLSQANSIPFFTLSMLATVKELMSKILN
VFYEKESHLDIEKTKFKVWFAKDSELNQNNSILNMSYKLDPYQFMSLPFLTRITEQNFGN
TLKNLKIETGDFVIEIKQEGKNYHWLSNYFHYNALTPSRGNIGLNNLGNTCYMNSALQCL
VHIPQLRDYFLYKVFEKEINLDNPLGYQGHVARSFAILIQNLFKDELLPSLSYSPTTFKS
TVGHFNSMFSGYLQQDSQEFIAFLLDGLHEDLNRITNKPVVEKPSLKPEDDVSNQEVIKK
LADDTWNSHLLRNDSIITDIFVGLYKSTLHCPECDNLSVTFDPYNDLTLPLPVDTKWNTK
IKLFPQNSPPCIIEIEMEKTSTYQELKEYIANLVKMNPSDLYGFEIFNHQFYNSFDSDKS
NSNYLPLKELISDADDIIFYEIKSSSPADMVVPVINTKLEEGFKNPRLFGVPFFVTLKED
ELNNPAAIRKVIETSYTRLSGGFVEFPLLELTENSSIEMFPLVKEKYPTINFGKYNPLIE
LANPDMSVDEYFKLRLMELTPNQQIRSRNATFNSDNGFRNDVWVPLSHININKAIDITGY
LDPVSRNIYNYLDLKNKFIEKDQGSDDCVEENDDTKSSTDDNEEESLAKDNDSESRAEFI
DQDTDMSNNDLIPQILKPTTFILAEWTDESANRVFTQDKVVDWETPAELKNIALEDERKK
RQMDGEKKITLDDCLNLFAKKEVLGMNDSWYCPTCKEHRQATKQLQLWSTPDILLIHLKR
FENQSSFSDKIDDTVYFPITDLDLSPYVVNNDESKSTIYDLVSVDNHYGGLGGGHYTAYV
KNFVDKKWYYFDDSRVTETVPERSIAGSAYLLFYMRRSDNTVGGEELKNLILKARSEFNL
KLQEFSKRQESLFLTNQTDEEDTSGEEDNEDDTDSRLNLNEADKSDFPVEDQSGSSRSTD
YSIESMEVGYSKANEVDNTNGDNSGRRKLRMLNKKYNVSTANSPASLSPSEDSDGNSVSI
IRSESDSVSTPGSDEVAKSPVKE
NT seq 3672 nt NT seq  +upstreamnt  +downstreamnt
atgtcaattgaaatggataatgacagtacaagtgatcattctttaagttccatttctagg
aggtcaagttatttgaatgtgtcggatggagatgacgtgactggggacgtagttcctgtt
gaatccatggcttcgactgctgaatgtttgatgaatagtaaattggatgaaaatattgag
gtaaaaccaggtttgccagaatacccagagatcactgatgaagtcataccatcgttacct
gaacaaaggcatctggtgttgcaattagctaaagaggcagatgtgaatgccaaggaaggg
gataaggtatatataattcctcaaaggtggtacgataattttatggatcccgatattcaa
gatttcaatcagataggatcaattgatacaaatataatttgtaaagattacgataatttt
atattgaatgactatgatgtaacaccatatctatcgattcaggaatctgttttcgaaaag
atatcttcgtggtatggattagcgccaaattcgaaaccaatagttacatgcttgatatat
gatgatcaatcggggtcattggtcactgaatataatagatgtattttcagactgcattac
ttaacagaagactcaaaaaccaaccagtatcgccatcatttgtcacaggctaatagcata
cctttttttactctatcaatgttagcaaccgttaaagagttgatgtctaaaatattaaac
gttttctatgaaaaagaatctcatctcgatatagaaaagacaaagtttaaagtatggttt
gcaaaagattcagagttgaaccaaaataatagcattttaaatatgtcttataaattggat
ccttatcaattcatgtcattaccttttctaacaagaataactgaacaaaattttgggaat
acattaaaaaatttgaaaatagaaactggtgattttgtaattgagataaaacaggaaggt
aaaaattatcactggttatcaaattactttcattataatgcattgaccccttccagagga
aatattggtttgaataacctaggtaatacatgctacatgaactcagccttacaatgttta
gttcatattcctcaacttcgtgactacttcttatataaggttttcgagaaggaaataaac
ctagacaatccattaggttatcaagggcatgttgctagatcatttgctatattgattcaa
aatttatttaaagatgaattgcttccttcgttatcttactcgccaacgactttcaaatct
accgtgggccacttcaattctatgttttcaggctacttgcaacaagattcccaggagttc
atagcatttttattagatggattacatgaagatttaaatagaataaccaacaagcctgtt
gttgaaaaaccctccctaaaaccagaagacgatgtcagcaatcaagaggtgatcaagaaa
ttagcagacgatacttggaattcccatcttctcaggaacgattcgatcattacagatatc
tttgttggattgtataaatcaacacttcactgtccagaatgtgacaatttatctgtaaca
ttcgatccttataatgatttgacacttccattgcctgttgatactaagtggaatactaaa
ataaagttatttcctcaaaattccccaccatgcataattgaaatagaaatggagaagact
tcgacttatcaagagttaaaggaatatattgcaaatctagtaaaaatgaatccaagtgat
ttatatggtttcgaaattttcaaccatcaattttacaatagttttgattctgataaatct
aattctaattatttacctcttaaagaattgatttctgatgccgatgacatcatcttctat
gaaattaaatcttcctcaccagccgatatggttgtcccagttattaataccaaattagaa
gaaggcttcaagaacccaagattatttggtgtaccattttttgtcactttaaaagaagac
gaattaaataatcccgctgctattagaaaagttatcgagacttcatataccagattgagt
ggtggatttgtggaatttcctcttcttgaattaacagaaaacagttctattgagatgttt
ccattagtgaaagaaaagtacccgactattaattttgggaaatataacccactaatagaa
ttagctaatcccgatatgtctgtcgacgagtacttcaaacttagattgatggaacttact
ccaaatcaacaaataagaagcaggaatgcaacctttaattccgataatggcttcagaaat
gatgtttgggtcccattatctcatattaatatcaataaagctattgatattaccggatat
cttgatccagtttcaagaaatatttacaactatttggatttgaagaataaatttatagaa
aaggatcaaggatccgatgattgtgtagaggaaaacgatgatacgaagtctagtactgat
gataatgaggaagaaagcttggcaaaagataatgatagtgaatctagagctgaatttatc
gatcaagatactgatatgtcaaataatgatttgataccacaaattctaaaacctactacg
tttatattagcagaatggacagatgaatcagccaatcgagtatttacccaagataaagtg
gttgactgggaaacaccagctgaattaaagaacatcgccttagaagatgaaagaaagaaa
agacagatggatggagaaaagaagataactctggatgattgtctaaatctatttgctaag
aaagaagttctgggaatgaacgattcttggtactgtccaacgtgtaaggaacataggcag
gcaacaaaacaacttcaattatggtccacaccagatattctgttgattcatttgaagagg
tttgaaaatcaaagctctttcagtgataaaatagatgatacagtttatttcccgataact
gatttggatttatctccatatgtagtaaacaatgatgagtctaagagtacaatttatgat
ttagtttctgttgacaatcattatggtggtctgggaggaggtcattacacagcttatgtc
aaaaatttcgtagataagaaatggtattactttgatgattcaagggtaacagagactgtt
cctgaacgaagcatagcaggctctgcatatttattattttatatgcgtaggtcggataat
actgtaggtggtgaggagttaaagaatctgatattaaaagcacgtagtgaatttaactta
aaactccaggaattctcaaaaagacaagaatctttgttcttgaccaaccagactgatgaa
gaagatacgagtggtgaagaggacaatgaagatgatacagattctagacttaatttaaat
gaggccgacaagtcagatttcccagtagaggaccagtctgggtctagtagatctacggat
tatagcattgaaagcatggaagttggatattcgaaagcaaacgaagtcgacaacactaat
ggtgataattctggaaggaggaagttacggatgttaaataagaaatataatgtttctaca
gccaattctccagcatccctttctccttccgaggattcggatggaaatagtgtaagtata
atcagatctgaatccgactctgtttctaccccaggtagcgatgaagttgccaaatcacct
gtaaaagaataa

DBGET integrated database retrieval system