KEGG   Vanderwaltozyma polyspora: Kpol_2001p78Help
Entry
Kpol_2001p78      CDS       T01049                                 

Definition
hypothetical protein
Orthology
K11871  
ubiquitin carboxyl-terminal hydrolase 7/11 [EC:3.1.2.15]
Organism
vpo  Vanderwaltozyma polyspora
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 403 aa AA seqDB search
MVQCLFGTKLLRDLFISSKYEKYLSKRIDRSSNLSRSFSILFKKMYLNGGCSVVPTSFLK
TCNQLRPDLRIPDDQQDTQEFLMLMLDRLHDELSNQETVGIDYPDLVLYDTRKLRVNNKE
YSKWFDKTIFANGLSPIDHIFQGQIENTLTCQRCGFVSYNYSTFYVLSLAIPKPSSGTFS
RSKRVKLEDCINMFTNDEVLSGENAWDCSNCGSSSVHNVEQRKDKTTGNGEEKKRSRKSR
LFLLPNINGRSSRSISPFRKSASPRPPHEKLKHKKLVTIKSMNFISLPPTLVIHLSRFYY
DLSKKNETIVTYPLILNIVLNNNETAKYRLYGIVNHTGNLISGHYTTLVNKEKNHELKKD
KQKWYYFDDEVVKEENNHGNIDEGVIKVSSSQVYVLFYERVYN
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atggtccagtgtctattcggaaccaaattactacgagatttgtttatctcttctaagtat
gaaaaatatttaagtaaacgaattgaccgttcctctaatctttccagatcttttagtatc
ctatttaagaagatgtacttgaatggtggttgctcagttgttccaacaagttttttaaag
acctgtaatcaattgcggccagatctaaggattccagatgatcaacaagatacacaagaa
tttctgatgttaatgttagatagacttcatgatgagttatctaatcaagagactgtaggt
attgactaccctgatttagttctttatgatacaaggaagttgagggtaaataataaagaa
tatagtaaatggtttgataaaactatatttgcgaatggattatcaccaattgatcatatt
tttcaaggtcagattgaaaatacactaacctgtcaacgttgtggttttgtatcgtataat
tattcaacattctatgttctatcattagccataccaaaaccatcttcaggaacattttct
agatcaaaaagagtaaaattggaagattgtattaatatgttcaccaatgacgaagtatta
agtggagaaaatgcatgggattgttctaattgtgggtccagttcagttcataatgttgaa
caaagaaaagataaaactactggtaacggtgaggaaaaaaagaggtctagaaaatcaaga
ctgtttttattaccaaatataaatggaagatctagtagatcaatatccccattcaggaaa
tctgctagtcctagaccacctcatgagaagttaaaacacaagaagctagtgacaataaaa
tcaatgaattttatttcacttccgcccacgctagttatacatctgtcaagattttattac
gatttaagcaaaaaaaatgaaacaattgtaacatatccactaatactaaacattgttctt
aataataatgaaactgcgaaatatcgtttatatggtattgttaatcatactggtaattta
ataagcggacattatactaccttagtcaacaaagaaaaaaaccatgaattaaagaaagat
aaacaaaaatggtactattttgacgacgaagtagtaaaagaagaaaataatcatggtaat
attgatgaaggtgtaataaaagtttcaagtagtcaagtttacgtcttattttatgaaagg
gtctataattaa

DBGET integrated database retrieval system