KEGG   Vanderwaltozyma polyspora: Kpol_2002p40Help
Entry
Kpol_2002p40      CDS       T01049                                 

Definition
hypothetical protein
Orthology
K14152  
phosphoribosyl-ATP pyrophosphohydrolase / phosphoribosyl-AMP cyclohydrolase / histidinol dehydrogenase [EC:3.6.1.31 3.5.4.19 1.1.1.23]
Organism
vpo  Vanderwaltozyma polyspora
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:vpo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Kpol_2002p40
  Amino acid metabolism
   00340 Histidine metabolism
    Kpol_2002p40
Enzymes [BR:vpo01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Kpol_2002p40
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.19  phosphoribosyl-AMP cyclohydrolase
     Kpol_2002p40
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.31  phosphoribosyl-ATP diphosphatase
     Kpol_2002p40
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 811 aa AA seqDB search
MVFPVLPRYTSDPIQVISERPFLLITGQALIDANKVKKDEIIEFIRKYGGYLKFTAVYVE
SDELLSGDDIVDLLNNGVTNIFTSNASFHQFLINEYNIPQNRVVVSADGTYTVKVGIVDT
FTDGRIVNIEDLDAQSISKSLISSLKTDRPDRLFPTLVVDTAERCLGLVYSSQESIQLAI
ERQVGVYFSRSRNQIWVKGETSGNTQKLINIQLDCDGDALKYVVIQGGAQSSFCHLNTES
CFGQLKYGLTSLETFINQRKLNAPAESYTKRLFNDSKLLNAKIKEEAEELTEAQSKDEVA
WEAADLLYFTITKLVAEGVTLQDVENNLELKHLKVTRRKGDAKPKFIEDDSKSSISEPKE
INSTEDKPIHLKVISSKDKTAVEVAVSRPIQKTSEIMHLVNPIVENVKNKGDKALIDYTA
KFDGVQLTASVLEAPFPEEYFEGLTEEMKQSLDLSMENVRKFHSAQLQKETMVVETQPGV
VCSRFSRPIEKVGLYIPGGTAILPSTALMLGVPAQVAGCKDIVFASPPRKSDGKVSPEVV
YVASKVGASKIVLAGGAQAVAAMAYGTETVPKVDKILGPGNQFVTAAKMYVQNDTQALCS
IDMPAGPSEVLVICDENADVDFVASDLLSQAEHGTDSQVILVGVNLSDEKIQQIQNAVHN
QAMELPRVDIVRKCIAHSSIINSDSYDEAFEVSNKYAPEHLILQIEDAQSYINQVDHAGS
VFVGAYTPESCGDYSSGTNHTLPTYGYARQYSGVNTSTFQKFITAQKISPEGLKSIGKAV
MCVAKVEGLDGHRNAVKIRMQKLGQIPQGFI
NT seq 2436 nt NT seq  +upstreamnt  +downstreamnt
atggtattcccagttttaccaaggtacacttctgatccaattcaagttatcagtgaaaga
ccatttttattgattactggtcaagctttgatcgatgcaaataaggttaagaaagatgaa
attatcgaatttattcgtaaatatggtggctatttgaaattcacagcagtttatgttgag
tctgatgagttattaagtggtgacgatatcgtagatttgttgaataatggtgttacaaat
attttcacttctaatgctagttttcatcaatttttaatcaatgagtacaatatccctcaa
aatagagttgtagtaagtgctgatggtacttatactgttaaggttgggattgtagatact
ttcactgatggacgtatcgttaatattgaagatttagatgctcaatccatttccaagagc
ttaatttcttccctaaagaccgacagacctgatcgtttatttcctactttggtggtagat
actgctgaacgttgtttaggtttagtatattcttcacaagaatcaatccagttagctatc
gagagacaagtaggtgtatatttctctcgttcacgtaatcagatttgggtaaaaggtgaa
acttcaggtaatactcaaaaattgattaatattcagttggattgcgacggtgatgcattg
aaatatgtagtaatacaaggaggtgcccaatcaagtttctgtcacttgaatactgaatca
tgcttcggccagttgaaatatggtttaactagtttagaaacttttattaatcaaaggaag
ttaaacgctcctgctgaatcttacaccaaaagattattcaatgattctaaattgttaaat
gctaaaattaaggaagaagctgaagaattgacggaagcacaatcaaaagatgaagttgca
tgggaagctgccgatttactctacttcactatcactaaattggtagcagaaggtgttaca
ttgcaagacgtcgagaataacttggaattaaagcacctgaaggtaacaagaagaaagggt
gatgccaagcctaaattcattgaagatgacagcaaaagctcaatctctgaaccaaaagaa
atcaactccactgaagataaacctattcacttaaaggtgataagttccaaggataagacc
gcagtagaagttgcagtttccagaccaattcagaaaacatctgaaataatgcacttagtc
aatccaattgtcgagaacgtcaaaaataaaggtgacaaagctttgatagattatacagct
aagtttgacggcgtacaacttacagcctctgttcttgaagctccattcccagaagaatat
tttgaaggtctaactgaagaaatgaaacaatctttagacttatcaatggaaaatgttaga
aagttccacagtgctcaattacaaaaagaaacaatggttgttgagacacaacctggtgtt
gtatgctcaagattctctagacctattgagaaggttggtttatatatccctggtggtact
gcaattttgccaagtacagcattaatgcttggtgttccagcgcaagttgctggctgtaaa
gatattgtctttgcgtcaccacctcgtaaatcagatggtaaagtttctccagaagtagta
tatgttgcttctaaagtaggtgcatcaaagattgtattggcaggtggtgctcaagcggtt
gctgccatggcttatggtactgaaactgtcccaaaggttgataaaattttgggtcctggt
aaccaatttgttacagccgcaaaaatgtatgtccaaaacgatacccaggccttgtgttca
attgacatgccagctggaccaagtgaagtattagttatttgtgatgaaaacgctgacgtc
gattttgttgccagtgacctgctatcacaagctgagcatggtactgactcccaggtcatt
ttagtgggtgtgaacttgtctgatgagaagatacaacagatacaaaatgctgtccacaac
caagcgatggaactacctcgtgtagatattgtaagaaagtgtatagcacacagttctatt
attaattcggattcatatgatgaagcttttgaagtttccaacaaatatgcaccagaacat
ttaattttacaaattgaggatgcacagagctatatcaaccaagtcgaccacgcaggtagt
gtatttgttggtgcttacactccagaatcatgtggtgattactccagtggtactaaccac
actttaccaacctacggttatgctaggcaatacagtggtgttaacacttcaactttccaa
aaatttattactgctcaaaagatctctccagaaggtttgaaaagcatcggcaaagctgtt
atgtgtgttgccaaagttgaaggtctagatggtcatagaaatgcagtcaaaattagaatg
caaaaattgggccaaattcctcaaggatttatctaa

DBGET integrated database retrieval system