KEGG   Vanderwaltozyma polyspora: Kpol_2002p75Help
Entry
Kpol_2002p75      CDS       T01049                                 

Definition
hypothetical protein
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
vpo  Vanderwaltozyma polyspora
Pathway
Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:vpo00001]
 Cellular Processes
  Cell growth and death
   04113 Meiosis - yeast
    Kpol_2002p75
Enzymes [BR:vpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     Kpol_2002p75
Protein kinases [BR:vpo01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   Kpol_2002p75
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 423 aa AA seqDB search
MYVDPQRNNEIRSLGIPNRKGNMASNGNSRYTDVISSETKDLRNETLLTKATPAANSTNT
GNDDDDDEDKDDDKEIEENVRTLQRRNEVDDDRNSSIAIQGRTTSGKYSLRDFQILRTLG
TGSFGRVHLVRSNHNGRFYALKVLKKHTVVKLKQVEHTNDERKMLSVVSHPFLIRMWGTF
QDSEQVFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHSMDIIYRDLKPE
NILLDKNGHIKITDFGFAKYVPDVTYTLCGTPDYIAPEVVSTKPYNKSVDWWSFGILIYE
MLAGYTAFYDSNTMKTYENILNAPLKFPPFFHPDVQDLLSKLITRDLSKRLGNLQGGSED
VKNHPWFSEVIWEKLLSRNIETPYEPPIRQGRGDTSQFERYPEEEINYGVQGEDPYHALF
QGF
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgtacgttgacccccagaggaacaacgaaatcagatccttaggaataccaaatagaaag
ggaaatatggcttcaaacggtaacagtagatatacagacgtgatctcttcagaaacgaag
gatttaaggaatgaaacattgttgacaaaggccactccagctgcaaattcgacaaataca
ggcaacgatgacgacgatgacgaggataaagatgatgacaaagagatcgaggaaaatgta
cgaactcttcagagaagaaatgaagttgacgatgatagaaattcatcaatagctatccaa
ggaagaactactagtgggaaatatagtttaagagatttccaaattctaagaaccctagga
actggttcctttggtagagttcatctagtgcgttcaaaccataatggaagattttatgca
ttaaaagtacttaaaaaacatacagtggtaaaattgaaacaagtggagcatactaatgat
gaaagaaaaatgctatcagtggttagccatccatttttaatccgtatgtgggggacattc
caagattcggaacaagtctttatggttatggattatatagaaggtggtgaattattctct
ctattacgtaaatcccaaaggtttccaaacccagtagccaaattctatgctgctgaagtt
tgcttagctttggaatatcttcatagcatggatatcatttacagagatttaaagcctgaa
aatattcttttagataaaaatggtcatatcaagataactgattttggattcgctaaatat
gttccagatgtcacttatacattgtgtggtacccctgattacattgctcctgaggtagtt
agtactaaaccttataataaatctgtagattggtggagtttcggtatattgatttatgaa
atgttggctggttatactgcattttatgattcaaacacaatgaaaacatatgaaaatatc
ttaaatgccccattaaagttcccaccatttttccatccagatgttcaagacttactgtca
aaattaattacaagagatttgagtaagagattgggtaacttacaaggtggcagtgaggat
gtcaaaaatcatccttggttcagcgaggtaatatgggagaaattattatctagaaatata
gaaacaccatacgagcctccaattagacaaggaagaggagatacctcgcaattcgaaagg
tatccagaagaagaaataaattatggtgttcaaggagaagacccttaccatgccctattc
caaggtttttaa

DBGET integrated database retrieval system