KEGG   Vanderwaltozyma polyspora: Kpol_2002p80Help
Entry
Kpol_2002p80      CDS       T01049                                 

Definition
hypothetical protein
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
vpo  Vanderwaltozyma polyspora
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 343 aa AA seqDB search
MATRLFTKRSYWLAAAAATTATAAVSFNYNADNNPFNRNSGNAKKVGVLTSAVAGLNVAI
PNKSKSIKDYQNVYNDIAEKIREEDEFDNYIGYGPILVRIAWHSSGTFDKNNMTGGSFGG
TMRFKKEINDPSNAGLKQADEFLAPIYKKHSWISHGDLYTLAGVTAVQEAQGPKIPWRPG
RVDQPENTTPENGRLPDATGDSSYVRNYFGRFGFNDTEIVALIGAHCLGKTHLENSGFEG
PWGAASNVFSNEFFVNLLNENWKLQKNAAGNEQYDSPKGYMMLPADFALRQDNKFLKLVK
AYANDQDLFFNDFAKAYVKLLESGIHFPADQKPFIFKTLDEQE
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atggctactagactattcactaaaagatcttactggttagctgctgctgctgccacaact
gccactgccgcagtatccttcaattacaatgctgataacaatccattcaacagaaacagt
ggtaatgctaagaaagttggtgttttgacctctgctgttgcaggtttgaacgtcgcaatc
ccaaataagtcaaagagcattaaagattaccaaaatgtctataacgatattgcagaaaaa
atcagagaagaagatgaattcgataactatattggttacggtccaatcttggttagaatt
gcttggcactcttctggtaccttcgataagaacaatatgacaggtggttcatttggtggt
accatgagattcaagaaggaaatcaatgatccatctaatgctggtttgaaacaagctgat
gaattcttggctccaatttataagaaacattcatggatttctcatggtgatttatacact
ttagcaggtgtcactgcagttcaagaagcacaaggtccaaagatcccatggagaccaggt
agagttgatcaaccagaaaacacaaccccagaaaacggtagattaccagacgctaccggt
gactcaagctatgttagaaattactttggtagatttggcttcaatgatactgaaattgtt
gcattgattggtgcccattgtttaggtaagactcatttggaaaactcaggatttgaaggt
ccatggggtgctgctagcaatgttttctccaatgaattctttgtaaacttactaaatgaa
aactggaaactacaaaagaatgcagctggtaacgaacaatacgattctccaaagggttac
atgatgctaccagctgatttcgcattaagacaagacaacaagttcttaaagttggtcaaa
gcttatgccaacgaccaagatctattcttcaacgatttcgctaaagcatacgtcaaatta
ttagaatctggtatccacttcccagctgatcaaaaaccattcatcttcaagactttagat
gaacaagaatag

DBGET integrated database retrieval system