KEGG   Vanderwaltozyma polyspora: Kpol_246p5Help
Entry
Kpol_246p5        CDS       T01049                                 

Definition
hypothetical protein
Orthology
K11483  
histone deacetylase HOS2 [EC:3.5.1.98]
Organism
vpo  Vanderwaltozyma polyspora
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 453 aa AA seqDB search
MPSASSSTFSYDIKTKNAQPMFEFGSAYCPRVSYHFNPKVSNYHYGVKHPMKPFRLMLTD
HLVSSYGLHKIMDLYETRSATKDELLDFHSDDYVSFLQKVTPENLSKMPRGTLEKYNIGD
DCPIFQNLYDYSALYAGASLDASRKLINNQSDIAINWSGGLHHAKKTNPSGFCYVNDIVL
AILNLLRYHPRVLYIDIDLHHGDGVQEAFYTTDRVFTISFHKYNGEFFPGTGNYDEIGCA
QGKHFAMNVPLEDGIDDDSYINLFKSIIDPLITSYKPTVIIQQCGADSLGHDRLGCFNLN
IKAHGECVKFIRSFGIPMLVVGGGGYTPRNVSRLWTYETGVLNNVLLPAELPEDIPFRDS
FGPDHSLYPVLDDLYENKNSKRYLEDLRIRCLEHIRYLQGAPSVRMDAEVIPVNDISGLT
EEEEDIIQELNQEDENWRLEQIEKENSKLSELM
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgccatcagcatcatcttcaactttttcttatgatatcaagactaaaaatgcacaacca
atgtttgaattcggttctgcttattgtcccagagtctcgtatcatttcaatcccaaagtc
tcaaactatcattatggtgttaaacatccaatgaaaccgttcagattaatgttaacagat
catctggtttcttcttatggtttacataagattatggatttatatgaaactagatctgct
acaaaggatgaacttttagatttccattccgatgactatgtaagtttcttgcaaaaagtg
acacctgaaaatctcagtaaaatgccaagaggtactttagaaaaatataatattggtgat
gattgcccaatttttcaaaatctatatgattacagtgccttgtatgctggtgcttcttta
gatgcctctagaaaattaattaataatcaatctgatattgcaattaattggtcaggtgga
ttgcatcatgctaaaaagacaaatccatcagggttctgttatgtcaatgatatagtattg
gcaattttaaatttattaagatatcatccaagggtcttatatatagatatagatttacat
catggtgatggtgtacaagaagcattttacacaactgatagagtctttacaatttctttc
cataaatataacggtgaattcttcccgggtactggtaattacgatgaaataggttgtgct
caagggaaacattttgcaatgaatgtaccactagaagatggtatagatgatgattcatat
ataaacctgttcaaatcaattatcgacccattaataacttcatacaaaccaacggtgatt
atacaacagtgtggtgcagattctttaggtcatgacagattaggttgtttcaatttaaat
attaaagctcatggtgaatgtgttaaattcattagatcatttgggattcccatgttagtg
gttggtggtggtggatacacaccaagaaatgtgtcacgattatggacctacgaaactggt
gtactaaataatgtcttgttacctgcagaacttccagaagatatacctttcagagattcg
tttggtcctgatcattccctatacccagtgctggacgatctttatgaaaataaaaatagt
aaaagatatctagaagatttgagaatacgatgtctagaacatataaggtatttacaaggt
gcaccaagtgttagaatggatgcagaggtcatcccagtaaatgatattagtggtttgact
gaagaagaagaagatataattcaggagttgaatcaagaagatgagaactggagattggaa
caaatagaaaaagaaaattcaaaactaagtgaactaatgtaa

DBGET integrated database retrieval system