KEGG   Vanderwaltozyma polyspora: Kpol_257p3Help
Entry
Kpol_257p3        CDS       T01049                                 

Definition
hypothetical protein
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
vpo  Vanderwaltozyma polyspora
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:vpo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Kpol_257p3
Enzymes [BR:vpo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Kpol_257p3
Exosome [BR:vpo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Kpol_257p3
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 344 aa AA seqDB search
MHVAQFLNLNDGTPAVEVGSVLSGGYNHPLLRAWQNERQLTKNMLIFPIFISDNDDDETA
IESLPNIKRFGVNKITAYLEPLIAKGLKSVIIFGVPLKEGVKDAIGTAADDPNGPVIKAI
KLLRKTFPDLYIICDVCLCEYTSHGHCGVLDDDGAINIEESVARLAMVALNYAKAGAHCV
APSDMIDGRIRMIKKGLLANGLANKTFVLSYSAKFSGNLYGPFRDAACSSPSSGDRKCYQ
LPTGGRGLARRALKRDLDEGADGIIVKPSTFYLDIMRDASEICQDFPICAYHVSGEFAML
HAAAEKGVVDLKTIAFESHQGFLRAGARLIITYLAPEFLDWLEQ
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgcatgttgctcaatttttgaatttgaacgatggaactccagctgtcgaagttggttct
gttctgtccggtggttacaaccatccattgctaagagcttggcaaaatgagagacaattg
actaaaaatatgttgattttcccaattttcatttctgataatgacgacgatgaaactgct
attgaatccttgcctaatatcaagagattcggtgttaataagatcactgcttatttggag
ccattgatcgctaaaggattgaagagtgtaatcatctttggtgtcccattgaaggaaggt
gtcaaggatgctatcggtactgctgctgatgatcctaacggtcctgtcatcaaggctatc
aaactgttgagaaagacattccctgatttatacattatctgtgatgtttgcttatgtgag
tacacatcccatggtcattgtggtgtgttggacgacgatggtgctatcaacatcgaagaa
tctgttgctagattagccatggtcgcattgaactacgctaaagctggtgctcactgtgtt
gctccatccgacatgattgatggtcgtatcagaatgatcaagaaaggtttgttggctaat
ggtttggccaacaagacctttgttttgtcttatagtgctaagttcagtggtaatctatat
ggtccatttagagatgccgcatgttcttctccatccagtggtgatcgtaaatgctaccaa
ttgcctacaggcggtagaggtttggccagaagagcgttgaagagagatcttgatgaaggt
gctgatggtattattgtcaagccatctacattctatttggatatcatgagagacgctagt
gaaatatgccaagacttcccaatttgcgcttatcacgtttctggtgagtttgcgatgttg
catgcagcagcagaaaagggtgtggttgatttgaagaccattgcatttgaatctcatcaa
gggttcctaagagctggtgccagattaatcatcacataccttgcaccagaatttttggac
tggttggaacaataa

DBGET integrated database retrieval system