KEGG   Vanderwaltozyma polyspora: Kpol_295p5Help
Entry
Kpol_295p5        CDS       T01049                                 

Definition
hypothetical protein
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
vpo  Vanderwaltozyma polyspora
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:vpo00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Kpol_295p5
Enzymes [BR:vpo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     Kpol_295p5
Glycosyltransferases [BR:vpo01003]
 Polysaccharide
  Storage polysaccharide
   Kpol_295p5
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 706 aa AA seqDB search
MGRDIQNHLLFEVATEVANRVGGIYSVLKSKAPTAVAQYGDNYTLVGPLNRSSYQSEVEE
LDINDPNTFPEDILPIKYVLESMRARGVHFVYGRWLIEGAPRVILFELGSVGHYLNDWKG
DLWSLVGIPSPENDAETNDAILLGYTVAWFLGELTTKDNNHAIVTHCHEWLAGVALPLCR
KRRIDVVTIFTTHATLLGRYLCASGSVDFYNNLDKFDVDHEAGKYGIYHRYCIERAAAHT
ADVFTTVSQITALEAEHLLKRKPDGILPNGINVTKFQAVHEFQNLHALKKAKINDFVRGH
FHGCFDFDLDETLYFFIAGRYEYKNKGADMFIEALARLNYRLKVSGSKKTVVAFIIMPAK
TNSFTVEALRSQAVVKALESSVKEVTHLIGERIFDHAIKYPHLGITSELPTNLDDIIKPS
DKVLLKRRVLALRRSDGQLPPIVTHNMADDSHDPILNQIRHVQLFNNASDRVKVIFHPEF
LNANNPILGLDYDEFVRGCHLGVFPSYYEPWGYTPAECTVMGVPSITTNLSGFGAYMEDL
IETDQAKDYGIYIVDRRFKNPEESVEQLVDMMEEFVKKNRRQRINQRNRTERLSDLLDWR
RMGLEYVKARQLALRRGYPDIFRQFTNGEDVNDSNMYTMAGNKKFKIMKPISVPGSPSES
RLRSGSVTTPTVYMTPGDLGTLQEANNADDYFMLANDQEDYEDNNE
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atgggtagagatattcaaaatcatctacttttcgaggtagctacagaagttgctaataga
gtcggtggtatttactcagttctaaaatcaaaggcaccaactgctgtcgcacaatatggt
gacaattataccttagttggacctttgaacagaagttcttaccaaagtgaagttgaagaa
ttggatataaatgatcctaataccttcccagaagatattttacctattaaatatgtattg
gaatcaatgagagctagaggtgtccatttcgtctacggtcgttggttgattgaaggagct
cctcgtgtcatcttgtttgaattaggttccgttggtcattatttaaatgattggaagggt
gatttatggtccttggttggtattccttctccagaaaatgatgccgaaactaatgatgcc
attttacttggttatactgttgcttggtttttaggcgaactaactacaaaggataacaat
catgcaattgtgacacattgtcacgaatggttagccggtgttgcccttcctttatgtaga
aagagacgtattgatgttgtaacaatctttaccactcatgcaactttattgggtagatac
ctatgtgcttcaggtagtgttgatttctataataacctagataaatttgacgtcgaccat
gaagctggtaaatacggtatctatcatagatattgtattgaacgtgctgccgcacatact
gccgatgtcttcaccactgtatctcaaattacagcattggaggcagaacatttattaaaa
cgtaaacctgatggtattttaccaaatggtatcaatgtcactaagttccaagctgtccac
gaattccaaaacttacatgcattgaaaaaggcaaagattaatgattttgtcagaggtcat
ttccatggctgctttgacttcgatttagatgagacattgtacttttttattgctggtaga
tatgaatataaaaataaaggtgctgatatgtttatagaagctttagccaggttaaattac
aggttaaaagtttcaggctctaaaaaaactgtagttgcttttatcattatgccagcaaag
acaaactcatttactgttgaagctttaagaagtcaagctgtcgtgaaagccttggaatct
tcggtaaaggaagtgacacatttgattggagaaagaattttcgatcatgctatcaagtat
ccacatttggggataacttcagaattaccaaccaatttagatgatattataaaaccttct
gacaaggttttattgaaaagacgtgttcttgctctaagaagatctgatggtcaattacca
ccaatcgtgacgcataatatggctgacgactctcacgaccctattcttaatcaaataaga
catgtacaattgtttaataatgcttctgatagagtcaaagttatcttccatcctgaattt
ctaaacgccaataacccaattttaggtctagattatgatgaatttgttcgtggttgtcac
ctaggtgtgttcccttcatattatgaaccttggggttatactccagctgaatgtactgtt
atgggtgtcccatctattactaccaatctttcaggatttggtgcttatatggaagattta
attgaaactgatcaagctaaagactatggtatttatattgttgatcgtcgtttcaaaaat
ccagaagaatcagttgaacaattagtagatatgatggaagaatttgtcaagaagaataga
agacaaagaatcaaccaaagaaatagaaccgaacgtctttctgatttattagattggaga
agaatgggtttagaatatgttaaagcaagacaactagctctacgcagaggttatcctgat
atatttagacaatttactaatggggaagatgtcaatgacagcaatatgtatacaatggca
ggcaataaaaaatttaaaattatgaaaccaattagtgtaccgggctcaccaagtgagtct
agactaagatcaggaagtgtcacaaccccaacagtttatatgactccaggtgatttgggt
actttacaagaagcaaacaacgctgatgattatttcatgttagcaaatgaccaagaggat
tatgaagataacaatgaataa

DBGET integrated database retrieval system