KEGG   Vanderwaltozyma polyspora: Kpol_344p5Help
Entry
Kpol_344p5        CDS       T01049                                 

Definition
(RefSeq) hypothetical protein
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
vpo  Vanderwaltozyma polyspora
Pathway
vpo00020  Citrate cycle (TCA cycle)
vpo00310  Lysine degradation
vpo01100  Metabolic pathways
vpo01110  Biosynthesis of secondary metabolites
vpo01130  Biosynthesis of antibiotics
vpo01200  Carbon metabolism
Module
vpo_M00009  Citrate cycle (TCA cycle, Krebs cycle)
vpo_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:vpo00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Kpol_344p5
  Amino acid metabolism
   00310 Lysine degradation
    Kpol_344p5
Enzymes [BR:vpo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Kpol_344p5
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 GCV_H BioT2 RnfC_N
Motif
Other DBs
NCBI-GeneID: 5542708
NCBI-ProteinID: XP_001642543
UniProt: A7TSS1
AA seq 457 aa AA seqDB search
MLSKQSVRSATRNTSVLKRALRTTTPLLNSSSISQNQNANVSQRCYSSSILSNNKLSKDL
WLQKSRLWRVTEKRWESTMVKVPPMAESLTEGALKEYTKAVGDFVTQDELLATIETDKID
IEVNSPVTGKVTKLCFQPEDTVTVGDELAEIEPGEAPAGGAASTDSASTPAPTPSPDAGK
EIPVVKTEAPKPEIKKESPQPAAPKVAQPAASSPTPAAESLTSFSRSEHKVKMNRMRLRI
AERLKESQNTAASLTTFNEVDMSAVMEMRKLYKDEIIKTKNIKFGFMGLFSKACTLAMKD
IPTVNAAIENDQIVYRDYTDISIAVATPKGLVTPVVRNAESLSVLGMEQEILRLGQKARD
GKLTLEDMSGGTFTISNGGVFGSLYGTPIINMPQTAVLGLHSVKQRPVTLPDGTIASRPM
MYLALTYDHRLLDGREAVTFLKTVKELIEDPRKMLLM
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgttgtccaaacaatctgttagatcagctacaagaaatacatctgttttgaaaagagct
ttacgtaccaccacccctttgttaaattcatcttcgattagtcagaatcaaaacgctaac
gtatcccaaagatgctactcttcttcgattttaagtaataacaagctctcaaaagattta
tggttacaaaaatctcgtctatggagagtcactgaaaaacgttgggaatccaccatggta
aaggtaccaccaatggcagaatcattgactgaaggtgctctaaaagagtataccaaagct
gtcggtgatttcgtcactcaagatgaattactagctaccatcgagactgataaaattgac
atcgaagttaactctccagtcacaggtaaagtcactaaattatgctttcaaccagaagat
acagtcactgttggagacgaattagcagaaattgaacctggtgaagctcctgctggcggt
gctgctagcaccgattcagcttcaactccagctccaaccccatccccagatgctggtaaa
gaaatcccagtcgttaaaaccgaggctccaaaaccagaaattaaaaaggaatctccacag
cctgcagctccaaaggttgcacaaccagctgcttcttccccaacccctgccgctgaatcc
ttaaccagcttttctcgtagtgaacacaaggttaagatgaaccgtatgagattgagaatc
gctgaaagattaaaggaatcccaaaatacagctgcttctttgactacattcaatgaagtc
gatatgtctgcagttatggaaatgagaaagttatacaaagatgaaattattaagaccaaa
aacattaaatttggtttcatgggtttgttttcaaaagcatgtactttagccatgaaggac
atcccaactgtaaacgctgctattgaaaatgatcaaattgtctaccgtgactatactgat
atctcaattgctgttgctacaccaaagggtctagttaccccagttgttcgtaacgcagaa
tccctatctgtcctaggtatggaacaagaaattctacgtctaggccaaaaggcccgtgat
ggtaaattaactttagaagatatgagtggcggtacttttactatttccaacggtggtgtc
tttggttctctatatggtactccaattattaacatgccacagactgctgttttgggtcta
catagtgttaaacagagaccagttacattgccagatggcaccattgcttcaagaccaatg
atgtatttggctttaacttacgatcatagattactagatggtagagaagctgttaccttt
ttgaagactgttaaagaattgatcgaagatccaagaaagatgcttttgatgtga

DBGET integrated database retrieval system