KEGG   Vanderwaltozyma polyspora: Kpol_344p5Help
Entry
Kpol_344p5        CDS       T01049                                 

Definition
hypothetical protein
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
vpo  Vanderwaltozyma polyspora
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:vpo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Kpol_344p5
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Kpol_344p5
  Amino acid metabolism
   00310 Lysine degradation
    Kpol_344p5
Enzymes [BR:vpo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Kpol_344p5
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 457 aa AA seqDB search
MLSKQSVRSATRNTSVLKRALRTTTPLLNSSSISQNQNANVSQRCYSSSILSNNKLSKDL
WLQKSRLWRVTEKRWESTMVKVPPMAESLTEGALKEYTKAVGDFVTQDELLATIETDKID
IEVNSPVTGKVTKLCFQPEDTVTVGDELAEIEPGEAPAGGAASTDSASTPAPTPSPDAGK
EIPVVKTEAPKPEIKKESPQPAAPKVAQPAASSPTPAAESLTSFSRSEHKVKMNRMRLRI
AERLKESQNTAASLTTFNEVDMSAVMEMRKLYKDEIIKTKNIKFGFMGLFSKACTLAMKD
IPTVNAAIENDQIVYRDYTDISIAVATPKGLVTPVVRNAESLSVLGMEQEILRLGQKARD
GKLTLEDMSGGTFTISNGGVFGSLYGTPIINMPQTAVLGLHSVKQRPVTLPDGTIASRPM
MYLALTYDHRLLDGREAVTFLKTVKELIEDPRKMLLM
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgttgtccaaacaatctgttagatcagctacaagaaatacatctgttttgaaaagagct
ttacgtaccaccacccctttgttaaattcatcttcgattagtcagaatcaaaacgctaac
gtatcccaaagatgctactcttcttcgattttaagtaataacaagctctcaaaagattta
tggttacaaaaatctcgtctatggagagtcactgaaaaacgttgggaatccaccatggta
aaggtaccaccaatggcagaatcattgactgaaggtgctctaaaagagtataccaaagct
gtcggtgatttcgtcactcaagatgaattactagctaccatcgagactgataaaattgac
atcgaagttaactctccagtcacaggtaaagtcactaaattatgctttcaaccagaagat
acagtcactgttggagacgaattagcagaaattgaacctggtgaagctcctgctggcggt
gctgctagcaccgattcagcttcaactccagctccaaccccatccccagatgctggtaaa
gaaatcccagtcgttaaaaccgaggctccaaaaccagaaattaaaaaggaatctccacag
cctgcagctccaaaggttgcacaaccagctgcttcttccccaacccctgccgctgaatcc
ttaaccagcttttctcgtagtgaacacaaggttaagatgaaccgtatgagattgagaatc
gctgaaagattaaaggaatcccaaaatacagctgcttctttgactacattcaatgaagtc
gatatgtctgcagttatggaaatgagaaagttatacaaagatgaaattattaagaccaaa
aacattaaatttggtttcatgggtttgttttcaaaagcatgtactttagccatgaaggac
atcccaactgtaaacgctgctattgaaaatgatcaaattgtctaccgtgactatactgat
atctcaattgctgttgctacaccaaagggtctagttaccccagttgttcgtaacgcagaa
tccctatctgtcctaggtatggaacaagaaattctacgtctaggccaaaaggcccgtgat
ggtaaattaactttagaagatatgagtggcggtacttttactatttccaacggtggtgtc
tttggttctctatatggtactccaattattaacatgccacagactgctgttttgggtcta
catagtgttaaacagagaccagttacattgccagatggcaccattgcttcaagaccaatg
atgtatttggctttaacttacgatcatagattactagatggtagagaagctgttaccttt
ttgaagactgttaaagaattgatcgaagatccaagaaagatgcttttgatgtga

DBGET integrated database retrieval system