KEGG   Vanderwaltozyma polyspora: Kpol_364p9Help
Entry
Kpol_364p9        CDS       T01049                                 

Definition
hypothetical protein
Orthology
K00493  
unspecific monooxygenase [EC:1.14.14.1]
Organism
vpo  Vanderwaltozyma polyspora
Pathway
Fatty acid degradation
Tryptophan metabolism
Brite
KEGG Orthology (KO) [BR:vpo00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    Kpol_364p9
  Amino acid metabolism
   00380 Tryptophan metabolism
    Kpol_364p9
Enzymes [BR:vpo01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     Kpol_364p9
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 492 aa AA seqDB search
MEFFIKFIIFCFVIFGVFIFKVVSPPLNFPRNIPTIPFYVSFLPIFYSIDQTELFELYLR
KPLERYGAVKYFFGSRWNILVSKRLFVKQMFKNEDVFAKSGNQKKIPYSLLALYTGDNVI
SAHGEIWKTYRSVVTNGLQHFDYEPLYKNSKLFCDLIEKSLETEENSESTVTVGPLIQRL
ALANISQVVLGFDFGTLTEEKCALQDHLIRIKKQIFHPFFLTFPFFDMLPLPQRRKGFKD
VSAFRNELVSKVRNDLINNYKFEQTTFTSSDLIRAYNNKLINYQQLTDNIVVLLVAGHEN
PQLAITTILYLLGKYHDSWQIAIRNEIGKLSKHDDLLQLPILNSFIFEALRVYPPLSIII
NRCTTKTCRLGNDIVIPKGAYVGYHNYSTTHNFESWGDDSDEFNPNRWGKTIEAIFHNWK
VAKMECTLPTFHGGKRACLGEKLALAELRLCIAEILKRFEWKLSKSWNNKMTPAGPLCPL
NLKLDFKKIESE
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggaattttttattaaatttattatattttgttttgttatttttggtgttttcattttc
aaagtagtatcaccaccattaaacttcccaagaaatattccaacaataccattctatgtt
tcctttttaccgatattttattcaattgatcagacagagttgtttgagttatacttgaga
aaacctttagaaagatatggtgctgttaaatatttttttggttctcgatggaatatatta
gtttcaaaaagactttttgttaaacaaatgtttaaaaatgaagatgtatttgccaagagt
ggtaatcaaaaaaagattccttacagtttattggctctatacacaggagataatgtcatt
agtgcacatggtgaaatatggaagacataccgtagcgttgtaacaaatggtttacaacat
tttgattatgaacctctttataagaattccaaattattttgcgacttgattgaaaaaagt
ttggagactgaagagaattcagagtcaactgttactgtgggtcctttaatccaaagacta
gcccttgcaaatatatctcaagttgttttaggtttcgattttggtacattaactgaagaa
aaatgtgctttacaagaccatttaattagaattaaaaaacaaatcttccatccatttttt
ttaaccttcccattctttgatatgcttcctttgcctcaaaggaggaaaggttttaaagat
gtctctgcctttagaaatgaattagtgtccaaggttagaaatgatttgattaacaactat
aaatttgaacaaacaactttcacatccagtgacctaattcgtgcttataataataaatta
ataaattatcaacaattaactgataatattgtggtattgttggtagctggtcatgaaaac
cctcagttggcaattacgacaattctatacttgcttggaaaatatcatgacagttggcaa
attgccataagaaatgaaattggtaaattaagcaaacatgatgatttattgcaattgcca
attttaaattccttcatttttgaagctttaagggtctacccacctttgagtataattata
aatagatgcacaaccaaaacttgtcgcttaggaaacgatatcgttataccaaagggagct
tatgtaggctatcataattattctacaacacataattttgagtcctggggagatgattct
gatgaatttaatcctaatagatggggaaaaaccattgaagcaattttccataattggaaa
gttgctaagatggaatgcactttaccaacattccatggtggaaaaagagcctgcttaggt
gaaaaattggctttggcagaattaagactctgtattgctgagatattaaaaaggtttgaa
tggaaattaagtaagagttggaacaacaaaatgactcccgctggcccactttgcccactt
aatttgaaattggattttaaaaagattgaatcagaataa

DBGET integrated database retrieval system