KEGG   Vanderwaltozyma polyspora: Kpol_376p5Help
Entry
Kpol_376p5        CDS       T01049                                 

Definition
hypothetical protein
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
vpo  Vanderwaltozyma polyspora
Brite
Enzymes [BR:vpo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     Kpol_376p5
Protein kinases [BR:vpo01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   Kpol_376p5
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 477 aa AA seqDB search
MLRTIHFHRVSYIFIYKLGSGKSVLKVRIDMKFGNSFPSTEVLTDQVTQEMSDNISQLQS
QKFDWKNYKYSSGSDRIKQLLHSQLDKAPSVDDTLPRTVYESVKFSLPGRYEVIQVLGKG
SYGTVCSVRDKKNPSNPYSIAVKKITNIFYREILLKRAIRELKFINYFRGHKNIVSLIDI
ELVTEKPYDGLYCYQELIDYDLAKVIHSSVQLTDFHIRHFFYQILCGIKYIHSADVIHRD
LKPGNILCTLNGTLKICDFGLARGVAPKYFAANQSRHDITNYVATRWYRAPELILSQKMY
DKSIDMWSAGCILAEFYGRKPKFMGKDSMHQIYEIIKVLGSPSKKLLSSFGSIKAWNMCN
SATPPHKKVEWRDIYPFACPDAIDLLDRLLRWEASDRLKVQESIEHPFLNEVRHPEDEPI
CPWGAFDFSYEENLTSMQRLREYLINEVSQFKEERNCKLSTPHVYKNITIIEEPEQL
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgttaaggacaatacatttccatagggtgtcctatatatttatttataaactaggtagt
ggtaaaagtgtattgaaggttagaattgatatgaaatttggcaatagtttcccatctact
gaggtgttgacagatcaagtcactcaagaaatgtcagacaatatatcacaattgcagtcc
cagaagtttgattggaagaactacaaatattcgtctgggtctgatcggataaagcaactg
ctacactctcagctcgataaagctcctagtgtagatgatactctacccagaacagtctat
gaaagtgttaaatttagccttcctggtcgatatgaagtgatccaagttttagggaagggc
tcatatggaacagtgtgctctgtaagagataagaaaaacccatcaaatccttattcaatt
gctgtcaaaaaaattactaatatcttctatagagaaattttgttaaagagagccattaga
gaattaaaatttattaattattttagaggtcataaaaatatagtaagcttaatcgatatt
gaattagtaacagaaaagccatatgatgggctctactgttaccaggaattgattgattat
gatttagccaaagtaatccattcttcagttcagttaacagatttccatatcaggcatttc
ttttatcaaattttatgtggtataaaatatatccattctgcagatgttatccacagagac
ttgaaacctggaaatatactttgtacattaaatggtactttaaagatttgtgattttggt
ttagcaagaggtgtggctccaaaatattttgcagctaatcaatctagacatgacattacg
aactacgtagcaacgaggtggtatagagcaccagaactaatactatcacaaaaaatgtat
gataagtcaatcgatatgtggtctgctggatgtatattagctgaattttatggtagaaaa
cccaaattcatgggtaaagattctatgcatcaaatttatgaaattatcaaagttcttggt
tcaccttcaaaaaaattattaagttcatttggatctattaaagcctggaacatgtgtaac
tcagcaactccacctcataaaaaagtagaatggagagacatttacccttttgcatgtcct
gatgcaatagatttacttgatagattattaagatgggaagcttcagatcgactaaaagta
caagaatcaatagaacaccctttcctgaatgaggtcagacatccagaagatgaacctatt
tgtccatggggtgcctttgatttttcatatgaagaaaatttgacttcaatgcaaagactt
cgtgaatatttaatcaatgaagtttcacaatttaaggaagagagaaattgtaagctttca
acaccacatgtctacaaaaatatcactatcattgaagaacctgaacaattgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system