KEGG   Vanderwaltozyma polyspora: Kpol_397p5Help
Entry
Kpol_397p5        CDS       T01049                                 

Definition
(RefSeq) hypothetical protein
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
vpo  Vanderwaltozyma polyspora
Pathway
vpo00010  Glycolysis / Gluconeogenesis
vpo00620  Pyruvate metabolism
vpo00640  Propanoate metabolism
vpo00680  Methane metabolism
vpo01100  Metabolic pathways
vpo01110  Biosynthesis of secondary metabolites
vpo01130  Biosynthesis of antibiotics
vpo01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:vpo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Kpol_397p5
   00620 Pyruvate metabolism
    Kpol_397p5
   00640 Propanoate metabolism
    Kpol_397p5
  Energy metabolism
   00680 Methane metabolism
    Kpol_397p5
Enzymes [BR:vpo01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Kpol_397p5
Lipid biosynthesis proteins [BR:vpo01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Kpol_397p5
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-GeneID: 5543200
NCBI-ProteinID: XP_001643004
UniProt: A7TRF7
AA seq 684 aa AA seqDB search
MTTKEHTVVHEAHNVNARQAPEHFYKSQPGKGYITSMDQYYKMYNESINNPDAFFSKMAK
EYLHWDRPFTKVQTGSIEKGDSAWFLNGELNAAYNCVDRHAFENPDKTAIIYEADDEKEN
RIITFGELLKQVSEVAGVLQSWGVKKGDTVAVYLPMIPEAVVAMLAVARLGAIHTVVFAG
FSAGSLKDRVVDAGCKVVITCDEGKRGGKTVNTKKIVDEGLNGVDSVSRILVFQRTGTEG
IPMRAGRDFWWHEETKKQRGYLPPVSCNSEDPLFLLYTSGSTGAPKGIVHTTGGYLLGAA
LTTRYVFDIHPEDVLFTAGDVGWITGHTYALYGPLALGTATIIFESTPAYPDYGRYWRII
ERHRATHFYVAPTALRLIKRVGEAEIPKYDTSSLRVLGSVGEPIAPDLWEWYHDKIGNKN
CVICDTMWQTESGSHLIAPLAGAVPTKPGSATVPFFGVNACIIDPVSGVELEGNDVEGVL
AVKSAWPSMARSVWDNHDRYIDTYLKPYPGYYFTGDGAGRDHDGYYWIRGRVDDVVNVSG
HRLSTAEIETSLVANDNVSESAVVGIHDDLTGQAVVAFVSLKNSDYIQENATEGDANHVT
PDALRRELVLHVRSEIGPFAAPKTVILVRDLPKTRSGKIMRRILRKVASNEADQLGDLST
IANAEIVPSIISAVETQFFNAKKK
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atgactacaaaagaacatactgtagtccacgaggctcataacgtcaatgctcgtcaagct
ccagaacatttctataaatctcaacctggtaaaggttacattaccagtatggatcaatat
tacaaaatgtataacgaatccattaataacccagatgcttttttctctaaaatggctaaa
gaatacctacattgggacagacctttcaccaaggttcaaactggttcaattgaaaaaggt
gattctgcttggttcttaaatggtgaattgaatgctgcttataactgtgttgatagacat
gctttcgaaaaccctgataaaaccgccattatctatgaagctgatgacgaaaaggaaaac
agaatcattacctttggtgaattgttaaaacaagtctctgaagttgctggtgtattacaa
agttggggtgtcaagaaaggtgatacagtcgctgtctacttgccaatgatcccagaagct
gtcgtcgctatgttagctgtcgccagattgggtgctatacatactgtcgtttttgctggt
ttctctgccggttcactaaaggatcgtgtagttgacgctggttgtaaagttgtcatcact
tgtgatgaaggtaagagaggtggtaaaactgtcaacactaagaaaatcgtcgatgaaggt
ttgaacggtgtcgattcagtttctcgtattttggttttccaaagaactggtactgaaggt
atcccaatgagagctggcagagatttctggtggcatgaagaaaccaagaaacaaagaggt
tacttaccacctgtttcttgtaactctgaagatccattgttcttgttatacacttctggt
tctactggtgctccaaagggtattgttcacaccactggtggttacttgttaggtgccgct
ttaacaactagatatgttttcgatattcatcctgaagatgttctatttactgctggtgac
gtcggttggattaccggtcacacttacgctttatacggtccattagctttaggtaccgct
acaattatttttgaatcaactccagcttatccagactacggtagatactggagaattatc
gaacgtcacagagccactcacttctacgttgctccaacggctttaagattaatcaaacgt
gttggtgaagccgaaattccaaaatatgacacttcttccttacgcgtgttaggttctgtc
ggtgaaccaatcgctccagatttatgggaatggtaccacgacaagattggtaacaagaac
tgtgttatttgtgacactatgtggcaaactgaatctggttctcatttaattgccccatta
gccggtgctgttccaaccaaaccaggttcagctactgtcccattcttcggtgtcaatgcc
tgtattatcgacccagtcagcggtgttgaattagaaggcaatgatgttgaaggtgttttg
gctgttaagtctgcttggccatcaatggctagatccgtatgggacaaccatgacagatac
attgatacctacttgaagccatacccaggttactatttcacaggtgacggtgctggtaga
gatcacgatggttactactggatcagaggtagagttgatgatgttgttaatgtttctggt
cacagattgtctacagccgaaatcgaaacttctctagttgctaatgataatgtttctgaa
tctgccgtcgttggtattcatgatgatttaactggtcaagcagttgtcgcattcgtttct
ttgaagaactctgattatatacaagaaaatgccactgaaggtgatgctaaccatgtcacc
ccagatgccttacgtcgtgaattagtcttacatgtaagatctgaaattggtccatttgcc
gctccaaagactgttatcttagtcagagatttaccaaagaccagatctggtaagatcatg
agaagaatcttaagaaaggttgcctctaacgaagctgatcaattaggtgatttaagtact
attgctaatgcagaaattgtaccatctattatctctgctgtcgaaacccaatttttcaac
gctaagaagaaataa

DBGET integrated database retrieval system