KEGG   Vanderwaltozyma polyspora: Kpol_423p16Help
Entry
Kpol_423p16       CDS       T01049                                 

Definition
hypothetical protein
Orthology
K04646  
clathrin heavy chain
Organism
vpo  Vanderwaltozyma polyspora
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:vpo00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    Kpol_423p16
Exosome [BR:vpo04147]
 Exosomal proteins
  Proteins found in most exosomes
   Kpol_423p16
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 1653 aa AA seqDB search
MSDLPIEFTELVDLTSLGISPQSLDFRSTTFESDRFVTVRETIDGANSVAIVDLANGNDV
TKKNMGGDSAIMHPSQMVISVRANGTIVQIFNLETKSKLKSFTLDEPVLFWKWLNEETLG
FVTARSILISNVFDGNVSGKPTLLTTRHQNLNNTQIINFVANKNLDWFAVVGILQENGRI
AGKIQLYSKQRNISQAIDGHVAIFSGIVLEGNGSSPVQVFVTGNRNVTTGSGELRIIEID
HDASLPTQYQKKTMEIFFPPDATNDFPIAVQVSEKYGVVYILTKYGFIHLYELETGTNLF
VNRITAESVFTATAYDNKNGIACINKKGQVLAVEISTSQIVQYVINKLSNVTLAISMARR
GGLPGADDLFQKQFDTLLSQGDYQNAAKVAASSQQLRNQNTINRLKNVQATPGSISPLLL
YFSTLLDNGKLNREETIELAKPVLQQDRKQLFEKWLKEDKLECSEELGDIVKPFDTTLAL
ACYLRANSHPKVVASLAELQQFDKILPYCEKAGYQPNFLVLISTLIRTSPDRASEFTTSI
LQNPAVAPQLDIEKIADLFFSQNHIQQGTALLLDALKSDTPDQGHLQTRVLEVNLLHAPQ
VADAILGNNIFSHYDKPTIASLSEKAGLFQRALENYVDIKDIKRCIVHTNALPVEWLVAY
FGKLNVEQSLACLKALMDNNMQQNIQIVVQVATKYSDLIGSPVLIKLFEEYNATEGLYYY
LASLVNLTDDKDLVYKYIEAAAKMKQYTEIERVVRDNNTYDPERVKNYLKDANLEDQMPL
VIVCDRFGFINELVIYLYNSQNLKFIESYVQQVNPSKTPEVVGSLIDLDCDENFIKGLLQ
SVFGQVPINELTTEVEKRNRLKLLLPYLEQSLAQGNQEQSVYNALAKIYIDSNNAPEKFL
KENDQYDTIDVGHYCEKRDPYLAYIAYDKGSNDDDLIRITNENSMYKYQARYLLKRSDPS
LWNKVLGEDNVHRQQLIDAVNSVGIPELTDPEPVSITVQAFMTNGLKLELIQLLEKIVLE
DSPFSDNVALQGLLLLSAIKYEPNKVRRYIEKLKNYDADEIASLCIEHDLKEEAFEIFDK
HELYNKALNVLVENVMSLDRAYSYVEKIDTKELWSQLGAAQLDGLRIPDAITSYIKAEDP
SNYESVIDVAVEAGNYEQLIPYLLMARKTLKESKIDGSLVLAYASLDKVHEIENLVANSN
AANLDAVGDKLLDMKNYKAAKLCFSSVSNYSKLAFTLVHIGDYQSAVDTARKASNIKVWK
LVNEACVDKKEFRLAQICGLNLIVHAEELNELVEKYESNGYFEELISLFEAGLGLERAHM
GMFTELSILYSKYEPSKTFDHLKLFWSRINIPKVIRAVEEAHLWQEVVFLYAHYDEWDNA
TLTMIEKCTKSFDHEYFKEIIVKVANLEIYYNAINFYVKKHPALLIDLLSVLTPRLDIPR
TVQIFAKSDNLPLIKPFLINVLPKNNSVVNQAYHDLMIEEEDHKALKDAVDSYDKFDQIA
LAERLEKHELIFFKKIAALLYRRNRKWAKSLSILKEEKLWKDAIDTAAISQDSKVVEDLF
TYFIETDNKEAVVALLYTAYNLFKYDFVLEMSWLNSLENYTKPYEISVKKEQTEAIEKLS
KQLGDRANVSDNKNAPGEPLMLTNGMGYQQTGF
NT seq 4962 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacttgcctatcgaatttaccgaattggttgatttaaccagtctagggatctct
cctcaatcccttgactttaggtcgaccacctttgaaagtgatcgtttcgttacagtaaga
gagacaattgatggtgctaattctgttgcaattgttgatctagcaaatgggaatgatgtt
accaaaaaaaatatgggtggtgattctgcaattatgcatccatcacaaatggtcatctct
gtcagagccaatggtactattgtacagattttcaatttagaaacaaagtctaaattgaaa
tcttttacattggatgaacctgttttgttttggaagtggttaaatgaagaaactttaggt
tttgttactgcaagatcaatccttatctccaacgtctttgatggcaatgttagtggaaaa
ccaactttattaactacaagacatcaaaatttaaataatactcaaattattaattttgta
gcaaataaaaacttagattggtttgctgttgtaggtattttacaagaaaatggccgtatc
gcaggtaaaatccaattgtattctaagcagcgtaatatttctcaagctattgatggtcac
gtagcaatcttttcgggaattgttttagaaggtaacggttcctcccctgtacaagttttc
gtcactggtaacagaaatgtcaccactggttcaggtgaattacgtatcattgaaatcgat
catgatgcttctttaccaacccaataccagaaaaagacaatggaaattttcttcccacca
gatgctaccaacgatttcccaattgctgttcaagtttctgaaaagtatggtgttgtttat
atcttaactaaatacgggttcattcatttatacgaattagaaactggtactaatttattt
gttaacagaattacagcagaatctgtattcacagctactgcttatgataataaaaatggt
attgcatgtatcaataagaagggtcaagtcttggctgtagaaatctctacttcccaaatt
gttcaatacgtaattaataaattatcaaacgtcaccttggctatctctatggctcgtaga
ggtggtttgccaggtgccgatgatttattccaaaagcaattcgatacattattatcccaa
ggtgattaccaaaatgctgctaaagttgcagcttcttctcaacaattaagaaatcaaaat
accattaacagattgaaaaatgttcaagccactccaggttctatttctccattattatta
tatttctctactttattagataatggtaaattgaacagagaagaaactattgaattggca
aagcctgtattacaacaagatagaaaacaattatttgaaaaatggttaaaagaagataag
ttagaatgctcagaagaattaggtgatatcgttaaaccatttgataccactttagcttta
gcttgttacttaagagcaaactctcatccaaaagttgttgcttctttagctgaattgcaa
caatttgataaaattttaccatattgtgaaaaagcaggttaccaaccaaatttcttagtt
ttgatttctactttaatcagaacttctcctgatagagcttcggaatttacaacttctatt
ttacaaaacccagctgttgccccacaactagatattgaaaagattgctgacttatttttc
tctcaaaaccacattcaacaaggtactgctttgttattagatgctttgaaaagtgataca
ccagatcaaggtcatttacaaactcgtgttcttgaagttaatttattgcatgcaccacaa
gttgctgatgctattctaggtaataacatcttttctcactatgataagccaaccatcgct
tccttatctgaaaaagctggtctgttccagagagctttagaaaattatgttgatataaaa
gatataaagagatgtattgttcatacaaatgccttacctgtagaatggttagtcgcatac
tttggtaaattaaatgttgaacaatcattggcttgtttgaaggctttaatggacaacaac
atgcagcaaaatattcagattgttgtccaagtagctactaaatattctgatctaatcggt
tctccagtgttgatcaagttatttgaagaatacaacgctactgagggtttgtactactac
ttagcttcattggtcaatctaaccgatgacaaagatttggtttataaatacatcgaagct
gctgctaagatgaaacaatataccgaaattgaaagagttgttagagataataatacttac
gacccagaaagagtaaagaattacttgaaggatgccaacttagaggatcaaatgccattg
gtaattgtttgcgatcgttttggctttattaatgaattggttatttacttgtacaattca
caaaacttaaagtttattgaatcttatgttcaacaagtcaacccatccaaaactccagaa
gtcgttggttctttaatcgacttagattgtgatgaaaactttattaagggtttgcttcaa
tcagtattcggccaagttccaatcaatgaattaaccactgaagtcgaaaagagaaataga
ttaaagttgttattaccttatttggaacaaagcttagctcaaggtaaccaggaacaatct
gtctacaatgcattggccaaaatctatatcgattctaacaatgccccagaaaagttcttg
aaggaaaatgatcaatatgacactattgatgttggtcattattgtgaaaagagagaccca
tacttggcttacattgcctacgataaaggctccaatgatgacgatttaatcagaattacc
aatgaaaacagcatgtacaagtaccaagctagatatttgttaaaacgttctgatccttca
ttatggaataaggttttaggtgaagataatgttcatagacaacaattaatcgatgctgtt
aattctgttggtatccctgaattgactgacccagaaccagtttcaattactgtacaagct
tttatgactaacggcttaaaattagagttaatccaattattggaaaaaatagttttagaa
gactctccatttagtgataacgtagctctccaaggcctattattgttatctgcaattaaa
tatgaaccaaataaggtaagaagatacatcgaaaagttgaaaaattatgatgctgatgaa
attgcctccttgtgtatcgaacacgatttgaaggaagaagcttttgaaatattcgacaaa
cacgagttgtacaacaaagccctaaatgttttagtcgagaatgtaatgtctttagataga
gcatactcttacgttgaaaagattgatacaaaagaattgtggtcccaattaggtgctgct
caacttgacggtttacgtattcctgacgctatcacatcttacataaaagcagaagatcca
tctaattatgaaagtgtgattgatgttgcagtcgaagctggtaattatgagcaattgatt
ccatacttattaatggctagaaaaactttgaaagaatcaaagatcgatggttctttagtt
ttggcttacgcttccttggacaaggtccatgaaatcgaaaacttggttgccaactctaat
gctgctaatttggatgcagttggtgataagttattggatatgaaaaactacaaggctgca
aaattatgcttctcaagcgtttctaattactctaagttagcctttactttggtccatatc
ggtgactatcaaagtgctgtcgatacagctagaaaagcttctaatatcaaggtttggaag
cttgttaacgaggcatgtgttgataaaaaggaattcagactagctcaaatttgtggttta
aatttgattgttcatgctgaagaattaaacgaactagttgaaaaatatgaatctaatggt
tactttgaagagttgatttccttgtttgaagctggtttaggtttagaaagggctcatatg
ggtatgtttacagagctatcaattttgtattcgaaatatgaaccttcaaaaacttttgat
cacttgaagttgttctggtcaagaattaatattccaaaggtaatcagagctgtcgaagaa
gcacatctatggcaagaagtagttttcttatatgcccattatgacgaatgggacaatgcc
acactaaccatgatcgaaaaatgtaccaaatctttcgatcacgaatacttcaaggaaatt
attgttaaagttgccaatcttgaaatctactataatgctattaacttctatgttaaaaag
cacccagcattattaatcgatttattgtcagttttgactccaagattagatattccaaga
acagttcaaatatttgcaaagtctgataacttgcctttgattaagccattcttgattaat
gttttaccaaagaacaactctgttgttaaccaagcatatcatgacttaatgattgaagaa
gaagatcacaaggctttaaaagacgctgttgactcatatgataaattcgatcaaattgct
ctagctgaacgtttggaaaaacatgaattaattttcttcaaaaaaattgctgctttactt
taccgtagaaacagaaagtgggcaaagagtttatctatcctaaaagaagagaagttatgg
aaagatgccattgatactgctgctatttctcaggattcaaaggttgttgaagatctattt
acctatttcatcgagacagacaacaaggaagctgttgtagcattattatacactgcctat
aatttgttcaagtatgacttcgttttggaaatgtcttggttgaattctttagaaaactat
accaaaccctatgaaatttctgtaaagaaagaacaaacagaagcaattgaaaagttatct
aaacaattaggtgacagagccaatgtatctgataacaaaaatgccccaggtgaaccactt
atgttgactaatggtatgggttaccaacaaactgggttttaa

DBGET integrated database retrieval system