KEGG   Vanderwaltozyma polyspora: Kpol_431p8Help
Entry
Kpol_431p8        CDS       T01049                                 

Definition
hypothetical protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
vpo  Vanderwaltozyma polyspora
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:vpo01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:vpo00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:vpo00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:vpo00350]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 380 aa AA seqDB search
MLRISTRSSIITPSKSFYLGRLIGARYQSQFAPNIPKVQKGVVFTEHNGELKYTDIPVPT
PKSNEILINVKYSGVCHTDLHAWKGDWPLAVKLPLVGGHEGAGVVVGIGENVKGWKLGDL
AGIKWLNGSCMSCELCETGHEANCEHADLSGYTHDGSFQQYATADAVQAARIPEGSDLAQ
IAPILCAGITVYKALKTANLKPGEWVAISGAAGGLGSLAVQYAKAMGYRVVGIDGGEEKE
KLFRSLGGEVFVDFTKSKDIVADIQNATKGGPQGVINVSVSEAAITQSTHYVRPTGTVVL
VGLPANSVVKSDIFSHVVKSINIVGSYVGNRADTREALDFFARGLIKSPIKVVGLSKLPE
VYKLMEANKILGRYVVDCAK
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgttaagaatttcaacaagatcatcaataataaccccatctaaatcattttatttaggc
agactgataggtgctcgttaccaaagtcaatttgcaccaaatattccaaaagttcaaaaa
ggtgttgtattcactgaacataacggtgaattaaaatatactgatatccctgtcccaaca
ccaaagtcaaatgaaattttaatcaacgttaaatattctggtgtctgccatactgatcta
catgcttggaaaggtgattggccattggctgttaaattaccattagttggtggtcatgaa
ggtgctggtgttgttgtaggtattggtgaaaatgtaaagggctggaaactaggtgatttg
gccggtattaaatggttaaatggttcatgcatgtcttgtgaactttgtgaaactggccat
gaagctaactgtgaacatgctgatttatcaggttacactcatgatggttcattccaacaa
tacgctactgctgatgctgttcaagctgctcgtattccagaaggctctgatctagcccaa
attgcaccaattctatgtgctggtattaccgtttacaaggctttgaagactgctaacttg
aaaccaggtgaatgggttgctatttcaggtgctgctggtggtttaggttcattagctgtc
caatatgcaaaagctatgggttacagagtagtaggtatcgatggtggtgaagaaaaagaa
aaattattcaggtcattaggtggtgaagttttcgttgatttcactaagtcaaaagatatc
gttgccgatattcaaaatgccaccaaaggtggcccacaaggtgtcatcaatgtttcagtt
tcagaagctgcaattacacaatccactcattatgtcagaccaactggtactgtagtattg
gtcggtttgccagctaactcagttgtcaaatctgatatcttttcgcatgttgttaaatct
ataaatattgttggttcttacgttggtaatagagctgatacaagagaagccttggacttc
tttgcaagaggtttaatcaagtctcctattaaggttgtcggtctatctaaactaccagaa
gtttacaaattgatggaagcaaacaagattttaggtagatatgttgttgattgtgccaaa
tga

DBGET integrated database retrieval system