KEGG   Vanderwaltozyma polyspora: Kpol_449p13Help
Entry
Kpol_449p13       CDS       T01049                                 

Definition
hypothetical protein
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
vpo  Vanderwaltozyma polyspora
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:vpo00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    Kpol_449p13
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    Kpol_449p13
Enzymes [BR:vpo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     Kpol_449p13
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 873 aa AA seqDB search
MIPLIRRLQYEEDTDNKQITRSSSNEVIGQEEYNYAVTFKDSKVTSIEVGVSRSRSLKGI
VKRTSDLVCFSRSSNIKADIGPLTTSRSMKYFLNYDLKRNVLPLELKDACDELRKGLSMI
RVTRRKKVAHIFKLNGTDSIKWNNNEKSLEIDSIKDIRVDTLAINYRKEYNIPDSSSNLW
ITVIFEVSKKLKALHLIANKHTDFQTFCTCIGGLVKYRYDLMKSVSVPESEKFANIHWHS
SVSEKKEDESKDTLSFVDIKRLCDKFHIYCSSKHLLKFFTAADINHNGLLNFKEFQTFVQ
LLKRRDEIIKVWESLTNCRQYLNLDEFHEFVTKIQKEKEDKASIFTIYNKFKSPDKKYMD
LNGFINYLSSQPYINDDVVDYSKPLNHYYIASSHNTYLLGKQFGETPSVEGYIQVLQQGC
RCVEIDIWDDENGPVVCHSFLTSSIPLLDVASVIRKYAFITSPYPLIISLETNCNKINQL
KAVSIFKDIFGDSLCTNILDGDALASPESLKLKVILKIKKTKRLDDIDNSKSSLSLSSSS
FESTGSSHGSSFESEYEATSFYDPENKTSKLSSMGIRRRIRRMSMKKQVHIIDELSEIAG
IQGLKFRNFSLPESKTRIHCFSLNEKKLEHLCKDTTQKLAVDKHNRRFLMRIYPHALRYK
SSNFDPIKCWEIGTQMVATNWQTNDLGHQLNLALFKLTDQKQELLHTGYALKPPKLLPEV
TKSRDLTQLYKETKKDPVTVCITLLSGQLLPKPKNIKSNEDTFAPYVVTEFICNCEPVKP
LMVKFGTALSPKVCSTPRCKENGFSPTWNTEMCITLKDIELAFVKFTVKTEESILASCTL
KLDYIRKGYRHIPLYNPKGEKYIFSTLFINTRA
NT seq 2622 nt NT seq  +upstreamnt  +downstreamnt
atgataccactgataagacgtttacaatatgaagaggacacagataataaacagataacg
agatcttcaagcaatgaagtcataggacaagaagaatataattatgctgtcacatttaag
gattctaaagttacatcaatagaagtaggggtatctagatcaagaagtttgaaaggaatt
gtcaaaaggacatcagatctagtttgcttctctcgcagttcaaatataaaggctgatatt
ggtcctttaactacatctagatcgatgaaatattttttaaattacgatttaaagaggaat
gtcttgccattagagttgaaagatgcatgcgatgagctgaggaaagggctatcaatgatt
agagtaacaagaagaaagaaagtagcgcatattttcaaacttaatggtacagattcaata
aagtggaacaataacgaaaaatcactggagatagactcaataaaagacatcagggtagat
acgctggccataaactaccgtaaagaatataatatcccagatagttcttcaaatctttgg
ataaccgttattttcgaagtttctaaaaaattaaaggcacttcatttaatagcaaataag
catactgactttcaaaccttttgtacttgcattggaggattagttaaatacagatatgat
ttgatgaaaagtgtctcagttccagaaagtgaaaagtttgcaaatatccactggcattct
tcagtttctgagaaaaaagaggatgaaagtaaagatactctttcttttgttgacatcaaa
agattgtgtgataaatttcatatttattgttcatccaagcacttgctaaagttttttacg
gcggctgatattaatcacaatggacttctcaatttcaaagagtttcagacgtttgttcag
cttctaaagagaagagatgaaattattaaagtttgggagtcactgaccaattgccgtcag
tatttaaatctagatgaattccatgaatttgtcactaaaatccagaaggagaaagaggac
aaagcatcaatatttacaatttacaataaatttaaaagtccagataagaagtatatggat
ctaaatggtttcattaactacctttcttcccaaccatatatcaatgatgatgtcgttgat
tattcaaagccgttaaatcattactatattgcatcatcacataacacatatcttttaggt
aaacaatttggcgaaaccccatctgtcgaagggtatatccaagtcttacaacaggggtgt
cgttgcgtagaaatcgacatatgggatgatgaaaatggacctgttgtttgtcacagtttt
ttgacatcttctatcccattattagatgttgctagtgttattagaaaatatgcgtttatc
acatcaccttaccctttaatcatctcgttagaaaccaattgtaataaaataaatcaatta
aaagctgtttcaatattcaaagatatttttggtgacagcctttgtaccaatatattagat
ggcgatgctttagcatctcccgaatcattgaaactaaaggtaatattaaaaataaaaaag
acaaaaagattagacgacattgataattctaaatcttcactttctctatcttcatcatct
tttgaaagcactggatcgtctcatggatcatcatttgagtcagaatatgaggcaacatcg
ttctatgatcctgagaacaaaacctctaaattatcctctatgggtattaggagacgaatt
agaaggatgagcatgaaaaagcaggttcatataatagacgagttatcggaaattgcaggt
attcagggtttaaaatttcgtaacttttccttaccagagtctaaaacacgaatccattgc
ttttcacttaatgaaaagaaactcgaacatttatgtaaggatactactcaaaaattagca
gttgacaaacacaatagaagattcctaatgagaatatacccacatgcattacgttataaa
tcatcaaattttgatcctatcaaatgctgggaaattggtactcaaatggtggctacaaac
tggcaaactaatgatcttggtcatcaattaaatttggcactttttaaactgacagatcaa
aaacaagagttattgcatactggctatgcattaaaacccccaaaattgttaccagaagtt
actaaatcgagagatttaacccaattatacaaggagaccaaaaaggatccagttaccgtt
tgtattacactgctatctggtcaattacttccaaaacccaagaacatcaagagtaatgaa
gatacatttgcaccttacgtggttactgaattcatctgtaattgtgaacctgtaaaacca
ctgatggtcaaatttggaactgcactttcaccaaaagtttgctcaactcctcgctgtaag
gaaaacgggttcagtccaacatggaatacagaaatgtgtattactttgaaggatatagaa
cttgcctttgttaaatttacagtaaaaacagaagaatcgatattagcgtcatgtaccttg
aaattagactacatcagaaagggttatcgccacattccattatataatcccaaaggtgag
aaatatatattttccaccctattcattaacacaagagcatag

DBGET integrated database retrieval system