KEGG   Vanderwaltozyma polyspora: Kpol_467p7Help
Entry
Kpol_467p7        CDS       T01049                                 

Definition
hypothetical protein
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
vpo  Vanderwaltozyma polyspora
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:vpo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Kpol_467p7
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Kpol_467p7
Enzymes [BR:vpo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Kpol_467p7
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 561 aa AA seqDB search
MSKMSKLILTRRFNHTTSYSKDLAQIEAFFNKKRFKNVKRPYKSIDVLKHRGSINYLQEN
ATPVSSLISRKLFNLLETHFKERKPLHTLGVLDPVQMSQLARCENIKVAYVSGWACSANA
NDNVSPDFGDYPYDTVPNQVGRIFNAQLMHDKKLHLQNFNSGRNNNSDKIDYLKPIIADA
DMGHGGITTVMKLAKLFAEKGASAIHLEDQLVGSKKCGHLGGTVVVPTSTHLQRIIATRF
QWDLMGAENLVIARTDSCNSNLISSDIDARDHKFIKGIAVENNDIRPVSEVLLEEELKQE
KYGHSTSSDSLNSIEQEWYKENKLLTFDEYMIQTLTDSEYTNLIKERSELLKKLGRRYLS
ISEMKQLANKISPRKNLTFNWYYPRTKEGHFMFNGCLEAAIERSLLFSYYSDLIWLETKT
PNLLQAKNFAMTIHEKNPNIKFVYNLSPSFNWEAQGFNQETLKSFIWDLAKHGFVLQLVS
LAGLHANGLGTWKLAKEFQYDGMKAYVNNIQNVERQTNSDMLTHQKWSGIDYIESISNVI
QNGQSSMTSSTSGSGFTEKHF
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaatgtcaaaactaatactgactagaagattcaaccatactacaagttactca
aaggatttagctcaaattgaagccttctttaataaaaaaagatttaaaaatgttaaaaga
ccatataaatcaatagatgttttaaaacatagaggttcaataaactatctacaagaaaat
gccactccagtatcttcattgatttcaagaaaactattcaatttattagagactcatttt
aaagagaggaaaccattacatactttaggtgtcctagacccagtccaaatgtcacaatta
gcaagatgtgaaaacataaaagttgcttacgtctcaggttgggcttgctctgcaaatgca
aatgataacgtttctccagattttggtgactacccttatgatactgtaccaaatcaagtc
ggtagaatatttaatgctcaattaatgcatgacaagaaattacatttacaaaatttcaac
tcaggtcgtaacaacaacagcgataaaatcgattacttaaaaccaattattgcagatgct
gatatgggccatggtggtattactaccgtaatgaaactggcaaaattatttgctgaaaag
ggtgcatccgcaatacatctggaagatcaattagttggaagtaaaaaatgtggacatttg
ggtggtactgtagtagtgccaacaagtacacatttacaaagaataatagcaacaagattc
caatgggatttaatgggtgctgaaaatttagttattgctagaactgattcttgtaattca
aacttaatcagtagtgatatcgacgctagagaccataaatttattaaagggatcgctgta
gaaaataatgatatcaggccagtaagtgaggttcttttagaagaagaattaaaacaagaa
aagtatggccacagtacttcaagtgacagtttgaactctattgaacaagaatggtacaaa
gaaaataaattactgacatttgatgaatatatgatccaaaccctgacagattctgagtat
accaacctcatcaaagaaagatcagaactgctaaagaaattaggcagacgttacttaagt
atatctgaaatgaagcaattggcaaataaaatatctccaagaaagaacctaacatttaac
tggtattacccaagaactaaagaaggtcatttcatgttcaatggctgtttagaagcggca
atagagagatctttattattttcatattattcagatttaatttggttagagactaaaact
ccaaatctattgcaagccaaaaattttgcaatgaccatccatgaaaagaatccaaacatt
aaatttgtctataatttatctccaagctttaattgggaagctcaagggtttaaccaagaa
acattaaaaagtttcatatgggatttagctaaacatggatttgttctgcaattagtatca
ttggcgggtttacatgccaatggattaggcacttggaaattagccaaagagttccaatat
gatggtatgaaggcatatgttaataacattcaaaatgtagagagacaaacgaatagtgat
atgttgacgcatcaaaaatggtcaggaattgattatatagaatccatctctaacgtaatt
caaaatgggcaatcttcaatgacgtctagtacttcaggtagtggattcacagaaaagcat
ttctaa

DBGET integrated database retrieval system