KEGG   Vanderwaltozyma polyspora: Kpol_467p7Help
Entry
Kpol_467p7        CDS       T01049                                 

Definition
(RefSeq) hypothetical protein
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
vpo  Vanderwaltozyma polyspora
Pathway
vpo00630  Glyoxylate and dicarboxylate metabolism
vpo01100  Metabolic pathways
vpo01110  Biosynthesis of secondary metabolites
vpo01200  Carbon metabolism
Module
vpo_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:vpo00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Kpol_467p7
Enzymes [BR:vpo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Kpol_467p7
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ICL PEP_mutase Cep57_CLD_2
Motif
Other DBs
NCBI-GeneID: 5543582
NCBI-ProteinID: XP_001643353
UniProt: A7TQF1
AA seq 561 aa AA seqDB search
MSKMSKLILTRRFNHTTSYSKDLAQIEAFFNKKRFKNVKRPYKSIDVLKHRGSINYLQEN
ATPVSSLISRKLFNLLETHFKERKPLHTLGVLDPVQMSQLARCENIKVAYVSGWACSANA
NDNVSPDFGDYPYDTVPNQVGRIFNAQLMHDKKLHLQNFNSGRNNNSDKIDYLKPIIADA
DMGHGGITTVMKLAKLFAEKGASAIHLEDQLVGSKKCGHLGGTVVVPTSTHLQRIIATRF
QWDLMGAENLVIARTDSCNSNLISSDIDARDHKFIKGIAVENNDIRPVSEVLLEEELKQE
KYGHSTSSDSLNSIEQEWYKENKLLTFDEYMIQTLTDSEYTNLIKERSELLKKLGRRYLS
ISEMKQLANKISPRKNLTFNWYYPRTKEGHFMFNGCLEAAIERSLLFSYYSDLIWLETKT
PNLLQAKNFAMTIHEKNPNIKFVYNLSPSFNWEAQGFNQETLKSFIWDLAKHGFVLQLVS
LAGLHANGLGTWKLAKEFQYDGMKAYVNNIQNVERQTNSDMLTHQKWSGIDYIESISNVI
QNGQSSMTSSTSGSGFTEKHF
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaatgtcaaaactaatactgactagaagattcaaccatactacaagttactca
aaggatttagctcaaattgaagccttctttaataaaaaaagatttaaaaatgttaaaaga
ccatataaatcaatagatgttttaaaacatagaggttcaataaactatctacaagaaaat
gccactccagtatcttcattgatttcaagaaaactattcaatttattagagactcatttt
aaagagaggaaaccattacatactttaggtgtcctagacccagtccaaatgtcacaatta
gcaagatgtgaaaacataaaagttgcttacgtctcaggttgggcttgctctgcaaatgca
aatgataacgtttctccagattttggtgactacccttatgatactgtaccaaatcaagtc
ggtagaatatttaatgctcaattaatgcatgacaagaaattacatttacaaaatttcaac
tcaggtcgtaacaacaacagcgataaaatcgattacttaaaaccaattattgcagatgct
gatatgggccatggtggtattactaccgtaatgaaactggcaaaattatttgctgaaaag
ggtgcatccgcaatacatctggaagatcaattagttggaagtaaaaaatgtggacatttg
ggtggtactgtagtagtgccaacaagtacacatttacaaagaataatagcaacaagattc
caatgggatttaatgggtgctgaaaatttagttattgctagaactgattcttgtaattca
aacttaatcagtagtgatatcgacgctagagaccataaatttattaaagggatcgctgta
gaaaataatgatatcaggccagtaagtgaggttcttttagaagaagaattaaaacaagaa
aagtatggccacagtacttcaagtgacagtttgaactctattgaacaagaatggtacaaa
gaaaataaattactgacatttgatgaatatatgatccaaaccctgacagattctgagtat
accaacctcatcaaagaaagatcagaactgctaaagaaattaggcagacgttacttaagt
atatctgaaatgaagcaattggcaaataaaatatctccaagaaagaacctaacatttaac
tggtattacccaagaactaaagaaggtcatttcatgttcaatggctgtttagaagcggca
atagagagatctttattattttcatattattcagatttaatttggttagagactaaaact
ccaaatctattgcaagccaaaaattttgcaatgaccatccatgaaaagaatccaaacatt
aaatttgtctataatttatctccaagctttaattgggaagctcaagggtttaaccaagaa
acattaaaaagtttcatatgggatttagctaaacatggatttgttctgcaattagtatca
ttggcgggtttacatgccaatggattaggcacttggaaattagccaaagagttccaatat
gatggtatgaaggcatatgttaataacattcaaaatgtagagagacaaacgaatagtgat
atgttgacgcatcaaaaatggtcaggaattgattatatagaatccatctctaacgtaatt
caaaatgggcaatcttcaatgacgtctagtacttcaggtagtggattcacagaaaagcat
ttctaa

DBGET integrated database retrieval system