KEGG   Vanderwaltozyma polyspora: Kpol_478p17Help
Entry
Kpol_478p17       CDS       T01049                                 

Definition
hypothetical protein
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
vpo  Vanderwaltozyma polyspora
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:vpo00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Kpol_478p17
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Kpol_478p17
Enzymes [BR:vpo01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Kpol_478p17
Lipid biosynthesis proteins [BR:vpo01004]
 Desaturase
  First
   Kpol_478p17
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 484 aa AA seqDB search
MSTLTQVESLDVSQANVLAQGLNKKNERVVNGFGSLMGSKEMVDFNKPTSSSSSSSHSQP
QSQSQSQKHISEQPWTFNNWHNHINWLNMVLVVFIPTLGWITAFSGLVPLHRNTLLFAAA
YYVLGGVCVTAGYHRLWSHRAYSARWPLRLFFGIFGSASVQGSIKWWGHSHRIHHRYTDT
PRDPYDARQGLWYSHMGWMLVKPNPKYKARADIQDLNDDWIVRFQHRHYVTIMIITAFVI
PSLVTGYFFNDYLGGFLYAGILRVFAIQQATFCINSMAHYIGAQPFDDKRTPRDNWMTAI
VTFGEGYHNFHHEFPSDYRNAIKWYQYDPTKMFIYANYIFGMAFDLKKFSQNAIEQALIQ
QQQKKIDAKSAKLNWGPRLTDLPVWSKDQFLENLKSDPELVVISGVVHNVKNYINDHPGG
KTLIKSALGKDATSAFNGGVYRHSNAAQNVLADFRVALLDDGKESALKLAAKRGEHYYDE
KKSL
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgtcgactctaactcaagtagagtctctagacgtctcgcaagctaacgtgctcgctcaa
ggtttgaataaaaaaaatgaaagagtcgtaaacggtttcggctctctaatgggaagtaaa
gaaatggtagacttcaataaacctacctcctcctcttcttcctcttcccattcacaaccc
caatcccaatcccaatcccaaaaacatatctccgaacaaccttggaccttcaacaactgg
cataatcacatcaactggctaaacatggtcctagtcgtattcatacctactctaggttgg
atcaccgccttctcaggtttggtcccattacatagaaacactctactcttcgctgccgct
tactacgttttgggtggtgtctgtgttactgccggttaccacagattgtggtctcacaga
gcctactccgcaagatggccactaagattgttctttggtatattcggttccgcttctgtc
caaggttcaatcaaatggtggggccactctcacagaattcaccacagatacacagacacg
ccaagagacccttacgacgcaagacaagggctatggtactctcacatgggttggatgttg
gtcaaaccaaacccaaaatacaaggccagagctgacatccaagatttgaacgatgactgg
atcgtcagattccaacacagacactatgtcacaattatgatcatcacagctttcgtcatc
ccttctctagtcaccggctacttcttcaacgactacctaggaggtttcctatacgcaggt
atcctaagagtattcgccatccaacaagccactttctgtattaactcaatggctcactat
atcggtgctcaaccttttgacgacaaaagaaccccaagagacaactggatgaccgctatc
gtcaccttcggtgaaggttaccataacttccaccacgaattcccttcggattatagaaac
gcaatcaaatggtatcaatacgaccctactaagatgttcatctacgcaaactacatattt
ggcatggcattcgatttgaaaaaattctcacaaaatgcaatcgaacaggctttaatccaa
caacaacaaaagaaaatcgacgccaagagtgctaaattgaactggggccctcgtctaact
gatctaccagtctggtcaaaggatcaattcttggaaaatttaaagagtgatccagaatta
gtcgtcatctccggtgttgtgcataacgttaagaactatatcaatgatcacccaggtggt
aaaactttaatcaaatcagctttgggtaaagacgccaccagcgctttcaatggtggtgtt
taccgtcactcaaacgctgctcaaaacgtcttggctgactttagagttgctctcttggac
gatggtaaagaatccgctttaaaattagctgcaaaaagaggtgaacattactacgatgaa
aaaaaatcattgtga

DBGET integrated database retrieval system