KEGG   Vanderwaltozyma polyspora: Kpol_479p16Help
Entry
Kpol_479p16       CDS       T01049                                 

Definition
hypothetical protein
Orthology
K03144  
transcription initiation factor TFIIH subunit 4
Organism
vpo  Vanderwaltozyma polyspora
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Class
Genetic Information Processing; Transcription; Basal transcription factors [PATH:vpo03022]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:vpo03420]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
AA seq 504 aa AA seqDB search
MSADLAKQSVNQYLEELPQPVQCKLYESPATCLAIYRLLPQLAKFFIMSMVFNDNEISLR
DLDRWVKASAKVQFQESIKCMKSLNLLIPGKEPGSIMVNLNPTFRKSLRNALSGGEINNS
FGIVVDSDNDLVTRAMLDSYSADKWETILHFMVGTPLVSIPSDNVLNLLKHSKLMEEVES
TGEFKITNEGFQFLLQEVNLQIWTLLLQYLKMAETFRMNPVDVLHFIFMLGALEFGKAYS
TEELSATQKTMMKDMRDYGLIFQKNSNTNVFYPTRLATMLTSDSRTVRNASSAMDSVLTQ
SKDEPSGATSGSADVDEQVGTQGQNIQDGALVVETNFKLYSYSNSPLQIAILSLFVHLKT
RFSNMVTGQITRESIRNALSNGITAEQIIAYLETHAHPQMRRLAEERLKKKLELDQNSKE
TLQILPPTVVDQIKLWQLELDRIISYEGSLYSDFDNKQEYDMLYSYAQDIGVLIWKDDRK
RKFFVSKESNSQVLDYAKRKLKKK
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgagtgctgatttggctaaacaatctgttaatcagtatttggaggaattgcctcaacct
gtgcaatgtaagttgtacgagtcgccagctacttgtttggctatatatcgtttgctacct
caattggcgaaatttttcattatgtctatggttttcaatgataatgagatttcgttacgt
gatctagatcgatgggttaaagcaagtgcaaaagtacagtttcaagaatcgattaaatgt
atgaaatctttgaatttgttgattccaggcaaagaaccaggttcaatcatggttaatttg
aatccaacttttagaaaaagtttgaggaatgcattgagtggtggtgagattaacaattca
tttggtattgtcgtggattcagataatgatcttgtcactagggcaatgttggatagctat
tctgctgataaatgggaaacaatcttgcatttcatggtgggaacaccgttggtgagcatt
ccttcggataatgttttgaacttgttgaaacatagtaaattgatggaagaggttgaaagt
acaggtgagtttaaaatcacaaatgaaggcttccaatttttattgcaagaggtgaattta
cagatttggactttgctattgcagtatttgaaaatggcagaaactttccgtatgaatccc
gtagatgtgttacactttatattcatgttaggtgctttggaatttggtaaagcttatagc
acagaagagttgagtgccactcaaaagacaatgatgaaagatatgagggattatgggttg
atctttcaaaagaattcaaatacaaacgttttttacccaactagattggcgactatgttg
acttctgattcgagaacagtgagaaacgcatcaagtgcaatggacagtgtcttgacacaa
agtaaagatgaaccaagcggtgcaacaagtggttctgcagacgtggatgaacaagttggt
actcagggacaaaacattcaagatggtgcattggtagtggagaccaactttaaattgtat
tcttactctaactctccattgcaaattgcgatcttatccctttttgtacatctgaagact
agattttctaatatggttacaggtcaaatcactagggaatccattagaaatgcactttcg
aacggtattacagcggaacaaattattgcgtatctagagacacatgcacatccacaaatg
agaaggttggcggaagaaaggttaaagaagaaactagaactggatcaaaactctaaagaa
actttacaaatacttcctccaactgtggttgatcagatcaaactatggcaactggaatta
gacagaattataagttacgaagggtcgctatattctgattttgataacaaacaggaatac
gacatgttatactcatatgctcaggacattggtgtgttgatatggaaagatgatagaaag
agaaagtttttcgtatctaaagaaagtaattcgcaagtattagattatgctaaacggaaa
cttaaaaagaaatag

DBGET integrated database retrieval system